PRGDB00062157 (disease resistance protein homolog)

From PRG Wiki
Jump to: navigation, search
disease resistance protein homolog
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 13924637 (AF258291)
Gene Class T
Domain Type TIR, LRR
Gene Species Brassica rapa

Comment?

Brassica rapa cultivar R500 disease resistance protein homolog (MPL12-5-BR-2) gene, partial cds.

DNA Sequence

CAGGAAGAGTGTGGTCAAATGGTGATACCTGTTTTCTACCGTTTAGATCCTTCCCATGTGAGGAAACAAACCGGTGAATTTGGTAAAATCTTTGAAAAGACATGCCACGACGAAACAGAGGAAGTGAAGATAAGATGGAGTGAAGCTTTGACCGATGTAGCTAATATCCTTGGATATCATTCTGTCATATGGGGTAACGAAGCAGACATGGTTGAAAAAATTGTCAATGATGTTATAGAGAAACTACTTTTAACTCCAGCAAAGGATTCTGAGGACTTTGTCGGCATCGAAGATCATATTGCAAAATTGAGTATGTTGTTGCAGTTGGAAGCAGAGGAAGTGAGGATGGTTGGTTTATGGGGTTCTTCCGGGATTGGAAAGACTACTATTGCAAGAGTTTTATTCAAC


Protein sequences

Name Description Sequence
disease resistance protein homolog disease resistance protein homolog [Brassica rapa].

QEECGQMVIPVFYRLDPSHVRKQTGEFGKIFEKTCHDETEEVKIRWSEALTDVANILGYHSVIWGNEADMVEKIVNDVIEKLLLTPAKDSEDFVGIEDHIAKLSMLLQLEAEEVRMVGLWGSSGIGKTTIARVLFN

Domains

Domain Start-End Description Sequence

ProfileScan: PS50104
IPR000157
1-56 TIR
Toll-Interleukin receptor

QEECGQMVIPVFYRLDPSHVRKQTGEFGKIFEKTCHDETEEVKIRWSEALTDVANI

superfamily: SSF52200
IPR000157
2-59 TIR
Toll-Interleukin receptor

EECGQMVIPVFYRLDPSHVRKQTGEFGKIFEKTCHDETEEVKIRWSEALTDVANILGY

Gene3D: G3DSA:3.40.50.10140
3-57 G3DSA:3.40.50.10140

ECGQMVIPVFYRLDPSHVRKQTGEFGKIFEKTCHDETEEVKIRWSEALTDVANIL

HMMPfam: PF01582
IPR000157
4-51 TIR
Toll-Interleukin receptor

CGQMVIPVFYRLDPSHVRKQTGEFGKIFEKTCHDETEEVKIRWSEALT

HMMPanther: PTHR23155:SF292
6-136 PTHR23155:SF292,SUBFAMILY NOT NAMED

QMVIPVFYRLDPSHVRKQTGEFGKIFEKTCHDETEEVKIRWSEALTDVANILGYHSVIWGNEADMVEKIVNDVIEKLLLTPAKDSEDFVGIEDHIAKLSMLLQLEAEEVRMVGLWGSSGIGKTTIARVLFN

HMMPanther: PTHR23155
6-136 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QMVIPVFYRLDPSHVRKQTGEFGKIFEKTCHDETEEVKIRWSEALTDVANILGYHSVIWGNEADMVEKIVNDVIEKLLLTPAKDSEDFVGIEDHIAKLSMLLQLEAEEVRMVGLWGSSGIGKTTIARVLFN

superfamily: SSF52540
76-136 SSF52540

NDVIEKLLLTPAKDSEDFVGIEDHIAKLSMLLQLEAEEVRMVGLWGSSGIGKTTIARVLFN

Gene3D: G3DSA:3.40.50.300
85-136 G3DSA:3.40.50.300

TPAKDSEDFVGIEDHIAKLSMLLQLEAEEVRMVGLWGSSGIGKTTIARVLFN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox