PRGDB00062158 (disease resistance protein homolog)

From PRG Wiki
Jump to: navigation, search
disease resistance protein homolog
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 13924635 (AF258290)
Gene Class T
Domain Type TIR, LRR
Gene Species Brassica napus

Comment?

Brassica napus cultivar Darmor disease resistance protein homolog (MPL12-5-BN-3) gene, partial cds.

DNA Sequence

GTGGTCAAATGGTGATACCTGTTTTCTACCGTTTAGATCCTTCCCATGTGAGGAAACAAACCGGTGAATTTGGTAAAATCTTTGAAAAGACATGCCACGACGAAACAGAGGAAGTGAAGATAAGATGGAGTGAAGCTTTGACCGATGTAGCTAATATCCTTGGATATCATTCTGTCATATGGGGTAACGAAGCAGACATGGTTGAAAAAATTGTCAATGATGTTATAGAGAAACTACTTTTAACTCCAGCAAAGGATTCTGAGGACTTTGTCGGCATCGAAGATCATATTGCAAAATTGAGTATGTTGTTGCAGTTGGAAGCAGAGGAAGTGAGGATGGTTGGTTTATGGGGTTCTTCCGGGATTGGAAAGACTACTATTGCAAGAGTTTTATTCAA


Protein sequences

Name Description Sequence
disease resistance protein homolog disease resistance protein homolog [Brassica napus].

GQMVIPVFYRLDPSHVRKQTGEFGKIFEKTCHDETEEVKIRWSEALTDVANILGYHSVIWGNEADMVEKIVNDVIEKLLLTPAKDSEDFVGIEDHIAKLSMLLQLEAEEVRMVGLWGSSGIGKTTIARVLF

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-55 TIR
Toll-Interleukin receptor

GQMVIPVFYRLDPSHVRKQTGEFGKIFEKTCHDETEEVKIRWSEALTDVANILGY

ProfileScan: PS50104
IPR000157
1-52 TIR
Toll-Interleukin receptor

GQMVIPVFYRLDPSHVRKQTGEFGKIFEKTCHDETEEVKIRWSEALTDVANI

Gene3D: G3DSA:3.40.50.10140
2-53 G3DSA:3.40.50.10140

QMVIPVFYRLDPSHVRKQTGEFGKIFEKTCHDETEEVKIRWSEALTDVANIL

HMMPfam: PF01582
IPR000157
2-47 TIR
Toll-Interleukin receptor

QMVIPVFYRLDPSHVRKQTGEFGKIFEKTCHDETEEVKIRWSEALT

HMMPanther: PTHR23155:SF292
2-131 PTHR23155:SF292,SUBFAMILY NOT NAMED

QMVIPVFYRLDPSHVRKQTGEFGKIFEKTCHDETEEVKIRWSEALTDVANILGYHSVIWGNEADMVEKIVNDVIEKLLLTPAKDSEDFVGIEDHIAKLSMLLQLEAEEVRMVGLWGSSGIGKTTIARVLF

HMMPanther: PTHR23155
2-131 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QMVIPVFYRLDPSHVRKQTGEFGKIFEKTCHDETEEVKIRWSEALTDVANILGYHSVIWGNEADMVEKIVNDVIEKLLLTPAKDSEDFVGIEDHIAKLSMLLQLEAEEVRMVGLWGSSGIGKTTIARVLF

superfamily: SSF52540
66-130 SSF52540

MVEKIVNDVIEKLLLTPAKDSEDFVGIEDHIAKLSMLLQLEAEEVRMVGLWGSSGIGKTTIARVL

Gene3D: G3DSA:3.40.50.300
81-130 G3DSA:3.40.50.300

TPAKDSEDFVGIEDHIAKLSMLLQLEAEEVRMVGLWGSSGIGKTTIARVL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox