PRGDB00062162 (putative disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 22711595 (AC022457)
Gene Class Unknown
Domain Type LRR
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa chromosome 10 BAC OSJNBa0006L06 genomic sequence, complete sequence.

DNA Sequence

CAACATGTTCACTGGAAATATCCCACCAGAGCTTGGTAAGGCAAGGAAACTGAATATGCTGTCCATGTACGACAATAGATTATCCGGCAGCATTCCTCCGGCATTGGGGAGCTTGACAAGCTTGAAGTATCTTGATCTGTCAGCGAATAATCTGACAGGAGGCATTCCATATGAGTTGGGTCATCTCAGCAATTTGCAATTCCTCAATCTTAGCCATAACTCCATTTCGGGGCCAATTATGGGAAATTTGGGAAACAATTTCAAGCTGCAGGGAGTTGGTTCATCAGGGAATTCCTCCAATTGCAGCTCTGGCTCAGCATTCTGCAGGCTGCTCTCCCTCGAGAATCTAGACCTTTCAAACAACAAGCTCACTGGTAAGCTGCCCGACTGCTGGTGGAACCTGCAGAATCTGCAGTTCATGGACCTCTCCCACAACGACTTCTCAGGTGAAATCTCTGCACTCGGGACAAGCTACAATTGTTCTCTTCATTCGGTATATCTTGCTGGCAACGGTTTCACTGGAGTTTTTCCATCAACTTTAGAGGGATGTAAGACACTGGTCTCCTTAGATTTTGGGAATAACAAGTTCTTCGGTAATATTCCTCCTTGGATTGGGAAAGGATTTCCTTCGATGAGGATTCTTATCCTTAAATCAAACAACTTCACTGGTGAAATTCCTTCGGAGTTGTCGCAGCTTTCTCAACTTCAACTACTAGACATGAGCAACAATGGTCTGACAGGATCGATTCCCAGATCTTTTAGTAACCTCACTTCCATGAAGAATAAAAAACTTAATATCTCCTCAGGAATTATTACAATGGCTTAGATGGCCGGCGTCGTCCACCGTTTCCTCCTCCTCCTCCTCTTCGTGGCGGCCGCCGTCATGCCAGCATCAACCAATGCCGCAGCGTCGTCGCAGACCGACGCGCTGCTGGCATGGAAGGCCAGCCTGACCGACGTGGCCGCGCTGTCCGCCTGGACGCGCGCCGCGCCGGTCTGCGGCTGGCGTGGCGTGGCCTGCGACGCCGCCGGCCTCGTCGCGAGGCTGCGGCTCCCGAGCTTGGGCCTCCGCGGCGGCCTCGATGAGCTCGACTTCGCGGCGCTCCCGGCGCTCACCGAACTCGACCTCAACGGGAATAACTTCACCGGCGCCATCCCGGCCAGCATCTCGCGGTTGGTATCCCTCGCGTCGCTTGACCTCGGCAACAACGGGTTCGTCGGCTCCATCCCGTCGCAGATCGGCGACCTCTCCGGCCTCGTCGAGCTCCGCCTCTACAACAACAACTTCGTCGGCAACATCCCGCACCAGCTCAGCTGGCTCCCCAAGATTACCCACTTCGACCTAGGGAATAATTGGCTGACCAACCCGGATTATCGCAAGTTCTCGACGATGCCCACCGTCAAGTTCCTGTCGCTCTTTGCCAACTCCCTCAACGGCAGCTTCCCGGAGTTCTTCCTCAGGAGCAGCAGCATCACCTACCTCGACCTGTCGCTGAACAATTTCTCTGGGTCAATACCAGACTTGCTGCCAGAGAAGCTCCCGAATCTGACGCACCTCAACTTGTCCATCAATGCGTTCTCCGGCCGAATTCCGGACTCGCTCAGGAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Oryza sativa Japonica Group].

MAGVVHRFLLLLLFVAAAVMPASTNAAASSQTDALLAWKASLTDVAALSAWTRAAPVCGWRGVACDAAGLVARLRLPSLGLRGGLDELDFAALPALTELDLNGNNFTGAIPASISRLVSLASLDLGNNGFVGSIPSQIGDLSGLVELRLYNNNFVGNIPHQLSWLPKITHFDLGNNWLTNPDYRKFSTMPTVKFLSLFANSLNGSFPEFFLRSSSITYLDLSLNNFSGSIPDLLPEKLPNLTHLNLSINAFSGRIPDSLRSNMFTGNIPPELGKARKLNMLSMYDNRLSGSIPPALGSLTSLKYLDLSANNLTGGIPYELGHLSNLQFLNLSHNSISGPIMGNLGNNFKLQGVGSSGNSSNCSSGSAFCRLLSLENLDLSNNKLTGKLPDCWWNLQNLQFMDLSHNDFSGEISALGTSYNCSLHSVYLAGNGFTGVFPSTLEGCKTLVSLDFGNNKFFGNIPPWIGKGFPSMRILILKSNNFTGEIPSELSQLSQLQLLDMSNNGLTGSIPRSFSNLTSMKNKKLNISSGIITMA

putative disease resistance protein putative disease resistance protein [Oryza sativa Japonica Group].

MAGVVHRFLLLLLFVAAAVMPASTNAAASSQTDALLAWKASLTDVAALSAWTRAAPVCGWRGVACDAAGLVARLRLPSLGLRGGLDELDFAALPALTELDLNGNNFTGAIPASISRLVSLASLDLGNNGFVGSIPSQIGDLSGLVELRLYNNNFVGNIPHQLSWLPKITHFDLGNNWLTNPDYRKFSTMPTVKFLSLFANSLNGSFPEFFLRSSSITYLDLSLNNFSGSIPDLLPEKLPNLTHLNLSINAFSGRIPDSLRSNMFTGNIPPELGKARKLNMLSMYDNRLSGSIPPALGSLTSLKYLDLSANNLTGGIPYELGHLSNLQFLNLSHNSISGPIMGNLGNNFKLQGVGSSGNSSNCSSGSAFCRLLSLENLDLSNNKLTGKLPDCWWNLQNLQFMDLSHNDFSGEISALGTSYNCSLHSVYLAGNGFTGVFPSTLEGCKTLVSLDFGNNKFFGNIPPWIGKGFPSMRILILKSNNFTGEIPSELSQLSQLQLLDMSNNGLTGSIPRSFSNLTSMKNKKLNISSGIITMA


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-534 PTHR24420,FAMILY NOT NAMED

MAGVVHRFLLLLLFVAAAVMPASTNAAASSQTDALLAWKASLTDVAALSAWTRAAPVCGWRGVACDAAGLVARLRLPSLGLRGGLDELDFAALPALTELDLNGNNFTGAIPASISRLVSLASLDLGNNGFVGSIPSQIGDLSGLVELRLYNNNFVGNIPHQLSWLPKITHFDLGNNWLTNPDYRKFSTMPTVKFLSLFANSLNGSFPEFFLRSSSITYLDLSLNNFSGSIPDLLPEKLPNLTHLNLSINAFSGRIPDSLRSNMFTGNIPPELGKARKLNMLSMYDNRLSGSIPPALGSLTSLKYLDLSANNLTGGIPYELGHLSNLQFLNLSHNSISGPIMGNLGNNFKLQGVGSSGNSSNCSSGSAFCRLLSLENLDLSNNKLTGKLPDCWWNLQNLQFMDLSHNDFSGEISALGTSYNCSLHSVYLAGNGFTGVFPSTLEGCKTLVSLDFGNNKFFGNIPPWIGKGFPSMRILILKSNNFTGEIPSELSQLSQLQLLDMSNNGLTGSIPRSFSNLTSMKNKKLNISSGIITM

HMMPanther: PTHR24420:SF504
1-534 PTHR24420:SF504,OS10G0469000 PROTEIN

MAGVVHRFLLLLLFVAAAVMPASTNAAASSQTDALLAWKASLTDVAALSAWTRAAPVCGWRGVACDAAGLVARLRLPSLGLRGGLDELDFAALPALTELDLNGNNFTGAIPASISRLVSLASLDLGNNGFVGSIPSQIGDLSGLVELRLYNNNFVGNIPHQLSWLPKITHFDLGNNWLTNPDYRKFSTMPTVKFLSLFANSLNGSFPEFFLRSSSITYLDLSLNNFSGSIPDLLPEKLPNLTHLNLSINAFSGRIPDSLRSNMFTGNIPPELGKARKLNMLSMYDNRLSGSIPPALGSLTSLKYLDLSANNLTGGIPYELGHLSNLQFLNLSHNSISGPIMGNLGNNFKLQGVGSSGNSSNCSSGSAFCRLLSLENLDLSNNKLTGKLPDCWWNLQNLQFMDLSHNDFSGEISALGTSYNCSLHSVYLAGNGFTGVFPSTLEGCKTLVSLDFGNNKFFGNIPPWIGKGFPSMRILILKSNNFTGEIPSELSQLSQLQLLDMSNNGLTGSIPRSFSNLTSMKNKKLNISSGIITM

HMMPanther: PTHR24420
1-534 PTHR24420,FAMILY NOT NAMED

MAGVVHRFLLLLLFVAAAVMPASTNAAASSQTDALLAWKASLTDVAALSAWTRAAPVCGWRGVACDAAGLVARLRLPSLGLRGGLDELDFAALPALTELDLNGNNFTGAIPASISRLVSLASLDLGNNGFVGSIPSQIGDLSGLVELRLYNNNFVGNIPHQLSWLPKITHFDLGNNWLTNPDYRKFSTMPTVKFLSLFANSLNGSFPEFFLRSSSITYLDLSLNNFSGSIPDLLPEKLPNLTHLNLSINAFSGRIPDSLRSNMFTGNIPPELGKARKLNMLSMYDNRLSGSIPPALGSLTSLKYLDLSANNLTGGIPYELGHLSNLQFLNLSHNSISGPIMGNLGNNFKLQGVGSSGNSSNCSSGSAFCRLLSLENLDLSNNKLTGKLPDCWWNLQNLQFMDLSHNDFSGEISALGTSYNCSLHSVYLAGNGFTGVFPSTLEGCKTLVSLDFGNNKFFGNIPPWIGKGFPSMRILILKSNNFTGEIPSELSQLSQLQLLDMSNNGLTGSIPRSFSNLTSMKNKKLNISSGIITM

HMMPanther: PTHR24420:SF504
1-534 PTHR24420:SF504,OS10G0469000 PROTEIN

MAGVVHRFLLLLLFVAAAVMPASTNAAASSQTDALLAWKASLTDVAALSAWTRAAPVCGWRGVACDAAGLVARLRLPSLGLRGGLDELDFAALPALTELDLNGNNFTGAIPASISRLVSLASLDLGNNGFVGSIPSQIGDLSGLVELRLYNNNFVGNIPHQLSWLPKITHFDLGNNWLTNPDYRKFSTMPTVKFLSLFANSLNGSFPEFFLRSSSITYLDLSLNNFSGSIPDLLPEKLPNLTHLNLSINAFSGRIPDSLRSNMFTGNIPPELGKARKLNMLSMYDNRLSGSIPPALGSLTSLKYLDLSANNLTGGIPYELGHLSNLQFLNLSHNSISGPIMGNLGNNFKLQGVGSSGNSSNCSSGSAFCRLLSLENLDLSNNKLTGKLPDCWWNLQNLQFMDLSHNDFSGEISALGTSYNCSLHSVYLAGNGFTGVFPSTLEGCKTLVSLDFGNNKFFGNIPPWIGKGFPSMRILILKSNNFTGEIPSELSQLSQLQLLDMSNNGLTGSIPRSFSNLTSMKNKKLNISSGIITM

Gene3D: G3DSA:3.80.10.10
29-259 G3DSA:3.80.10.10

SSQTDALLAWKASLTDVAALSAWTRAAPVCGWRGVACDAAGLVARLRLPSLGLRGGLDELDFAALPALTELDLNGNNFTGAIPASISRLVSLASLDLGNNGFVGSIPSQIGDLSGLVELRLYNNNFVGNIPHQLSWLPKITHFDLGNNWLTNPDYRKFSTMPTVKFLSLFANSLNGSFPEFFLRSSSITYLDLSLNNFSGSIPDLLPEKLPNLTHLNLSINAFSGRIPDSL

HMMPfam: PF08263
IPR013210
29-66 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

SSQTDALLAWKASLTDVAALSAWTRAAPVCGWRGVACD

Gene3D: G3DSA:3.80.10.10
29-259 G3DSA:3.80.10.10

SSQTDALLAWKASLTDVAALSAWTRAAPVCGWRGVACDAAGLVARLRLPSLGLRGGLDELDFAALPALTELDLNGNNFTGAIPASISRLVSLASLDLGNNGFVGSIPSQIGDLSGLVELRLYNNNFVGNIPHQLSWLPKITHFDLGNNWLTNPDYRKFSTMPTVKFLSLFANSLNGSFPEFFLRSSSITYLDLSLNNFSGSIPDLLPEKLPNLTHLNLSINAFSGRIPDSL

HMMPfam: PF08263
IPR013210
29-66 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

SSQTDALLAWKASLTDVAALSAWTRAAPVCGWRGVACD

superfamily: SSF52047
73-385 SSF52047,LRR

RLRLPSLGLRGGLDELDFAALPALTELDLNGNNFTGAIPASISRLVSLASLDLGNNGFVGSIPSQIGDLSGLVELRLYNNNFVGNIPHQLSWLPKITHFDLGNNWLTNPDYRKFSTMPTVKFLSLFANSLNGSFPEFFLRSSSITYLDLSLNNFSGSIPDLLPEKLPNLTHLNLSINAFSGRIPDSLRSNMFTGNIPPELGKARKLNMLSMYDNRLSGSIPPALGSLTSLKYLDLSANNLTGGIPYELGHLSNLQFLNLSHNSISGPIMGNLGNNFKLQGVGSSGNSSNCSSGSAFCRLLSLENLDLSNNKLT

superfamily: SSF52047
73-385 SSF52047,LRR

RLRLPSLGLRGGLDELDFAALPALTELDLNGNNFTGAIPASISRLVSLASLDLGNNGFVGSIPSQIGDLSGLVELRLYNNNFVGNIPHQLSWLPKITHFDLGNNWLTNPDYRKFSTMPTVKFLSLFANSLNGSFPEFFLRSSSITYLDLSLNNFSGSIPDLLPEKLPNLTHLNLSINAFSGRIPDSLRSNMFTGNIPPELGKARKLNMLSMYDNRLSGSIPPALGSLTSLKYLDLSANNLTGGIPYELGHLSNLQFLNLSHNSISGPIMGNLGNNFKLQGVGSSGNSSNCSSGSAFCRLLSLENLDLSNNKLT

HMMPfam: PF12799
95-130 LRR_4,Leucine Rich repeats (2 copies)

ALTELDLNGNNFTGAIPASISRLVSLASLDLGNNGF

HMMPfam: PF12799
95-130 LRR_4,Leucine Rich repeats (2 copies)

ALTELDLNGNNFTGAIPASISRLVSLASLDLGNNGF

HMMPfam: PF00560
IPR001611
215-233 LRR_1
Leucine-rich repeat

SITYLDLSLNNFSGSIPDL

HMMPfam: PF00560
IPR001611
215-233 LRR_1
Leucine-rich repeat

SITYLDLSLNNFSGSIPDL

HMMPfam: PF13516
238-256 LRR_6,Leucine Rich repeat

LPNLTHLNLSINAFSGRIP

HMMPfam: PF13516
238-256 LRR_6,Leucine Rich repeat

LPNLTHLNLSINAFSGRIP

Gene3D: G3DSA:3.80.10.10
260-416 G3DSA:3.80.10.10

RSNMFTGNIPPELGKARKLNMLSMYDNRLSGSIPPALGSLTSLKYLDLSANNLTGGIPYELGHLSNLQFLNLSHNSISGPIMGNLGNNFKLQGVGSSGNSSNCSSGSAFCRLLSLENLDLSNNKLTGKLPDCWWNLQNLQFMDLSHNDFSGEISALG

Gene3D: G3DSA:3.80.10.10
260-416 G3DSA:3.80.10.10

RSNMFTGNIPPELGKARKLNMLSMYDNRLSGSIPPALGSLTSLKYLDLSANNLTGGIPYELGHLSNLQFLNLSHNSISGPIMGNLGNNFKLQGVGSSGNSSNCSSGSAFCRLLSLENLDLSNNKLTGKLPDCWWNLQNLQFMDLSHNDFSGEISALG

HMMPfam: PF13855
277-336 LRR_8,Leucine rich repeat

KLNMLSMYDNRLSGSIPPALGSLTSLKYLDLSANNLTGGIPYELGHLSNLQFLNLSHNSI

HMMPfam: PF13855
277-336 LRR_8,Leucine rich repeat

KLNMLSMYDNRLSGSIPPALGSLTSLKYLDLSANNLTGGIPYELGHLSNLQFLNLSHNSI

superfamily: SSF52058
366-533 SSF52058,LRR

SAFCRLLSLENLDLSNNKLTGKLPDCWWNLQNLQFMDLSHNDFSGEISALGTSYNCSLHSVYLAGNGFTGVFPSTLEGCKTLVSLDFGNNKFFGNIPPWIGKGFPSMRILILKSNNFTGEIPSELSQLSQLQLLDMSNNGLTGSIPRSFSNLTSMKNKKLNISSGIIT

superfamily: SSF52058
366-533 SSF52058,LRR

SAFCRLLSLENLDLSNNKLTGKLPDCWWNLQNLQFMDLSHNDFSGEISALGTSYNCSLHSVYLAGNGFTGVFPSTLEGCKTLVSLDFGNNKFFGNIPPWIGKGFPSMRILILKSNNFTGEIPSELSQLSQLQLLDMSNNGLTGSIPRSFSNLTSMKNKKLNISSGIIT

HMMPfam: PF00560
IPR001611
373-394 LRR_1
Leucine-rich repeat

SLENLDLSNNKLTGKLPDCWWN

HMMPfam: PF00560
IPR001611
373-394 LRR_1
Leucine-rich repeat

SLENLDLSNNKLTGKLPDCWWN

FPrintScan: PR00019
374-387 LEURICHRPT,Leucine-rich repeat signature

LENLDLSNNKLTGK

FPrintScan: PR00019
374-387 LEURICHRPT,Leucine-rich repeat signature

LENLDLSNNKLTGK

Gene3D: G3DSA:3.80.10.10
422-521 G3DSA:3.80.10.10

SLHSVYLAGNGFTGVFPSTLEGCKTLVSLDFGNNKFFGNIPPWIGKGFPSMRILILKSNNFTGEIPSELSQLSQLQLLDMSNNGLTGSIPRSFSNLTSMK

Gene3D: G3DSA:3.80.10.10
422-521 G3DSA:3.80.10.10

SLHSVYLAGNGFTGVFPSTLEGCKTLVSLDFGNNKFFGNIPPWIGKGFPSMRILILKSNNFTGEIPSELSQLSQLQLLDMSNNGLTGSIPRSFSNLTSMK

HMMPfam: PF13516
444-461 LRR_6,Leucine Rich repeat

CKTLVSLDFGNNKFFGNI

HMMPfam: PF13516
444-461 LRR_6,Leucine Rich repeat

CKTLVSLDFGNNKFFGNI

FPrintScan: PR00019
493-506 LEURICHRPT,Leucine-rich repeat signature

LSQLQLLDMSNNGL

FPrintScan: PR00019
493-506 LEURICHRPT,Leucine-rich repeat signature

LSQLQLLDMSNNGL

HMMPfam: PF00560
IPR001611
495-517 LRR_1
Leucine-rich repeat

QLQLLDMSNNGLTGSIPRSFSNL

HMMPfam: PF00560
IPR001611
495-517 LRR_1
Leucine-rich repeat

QLQLLDMSNNGLTGSIPRSFSNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox