PRGDB00062163 (putative disease resistance protein; 46848-50365)

From PRG Wiki
Jump to: navigation, search
putative disease resistance protein; 46848-50365
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 12324896 (AC020579)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 1 BAC F1O17 genomic sequence, complete sequence.

DNA Sequence

ATGGGGCAGTTACATGGATACAAAAGTTGTATTGATGAAGAAAAGATCGCTTTGTTTGAGCTCAGGAAACACATGATCTCAAGAACTGAATCCGAGTCTGTTCTCCCTACTTGGACCAATGATACAACGAGCGATTGCTGTCGATGGAAGGGCGTTGCTTGCAATCGTGTAAGCGGACGGGTGACCGAGATTTCCTTTGGTGGACTGAGCCTAAAAGATAATTCTCTCCTAAATCTTTCTTTGTTGCATCCCTTTGAAGATGTTCGAAGTTTGAACTTATCAAGCTCCAGATGCAGTGGCTTGTTTGATGATGTGGAAGGTTATAAAAGCCTCAGAAAATTAAGAAAGTTGGAGATTCTGGATTTGGCTTCAAATAAATTCAACAACAGTATATTTCATTTTCTTAGTGCCGCTACATCACTCACAACTCTGTTTCTTAGGTCCAACAACATGGATGGCTCTTTTCCTGCTAAAGAACTTAGAGATTTGACAAACTTGGAATTACTAGACCTGAGTAGAAACAGATTTAACGGCTCCATACCAATACAAGGGATTTGTGAATTGAATAATATGCAAGAGCTTGATCTCAGTCAAAACAAACTCGTAGGCCATCTCCCCTCATGTTTAACTAGCTTGACTGGCCTTCGAGTTCTTGACCTTTCATCGAACAAATTAACTGGGACGGTTCCTTCTTCTCTCGGTAGCCTACAATCCCTTGAGTACTTATCGTTGTTTGATAACGACTTTGAAGGTTCTTTCTCATTTGGTTCACTCGCCAACCTCTCAAACCTAATGGTGTTGAAACTTTGCTCAAAGTCCAGCTCTCTTCAAGTACTGTCCGAAAGTTCTTGGAAGCCAAAATTTCAGCTGAGTGTTATTGCGCTACGATCATGCAACATGGAGAAGGTTCCTCATTTTCTCCTACACCAGAAGGATTTGCGTCATGTTGATCTCTCCGACAATAATATCTCTGGAAAGCTTCCTTCTTGGTTATTGGCAAACAATACAAAACTCAAAGTTCTGCTTCTACAGAATAATCTCTTTACAAGCTTTCAGATACCTAAATCTGCTCATAATCTGCTTTTCCTCGATGTGTCAGCTAATGACTTCAACCATCTTTTTCCTGAGAACATTGGATGGATCTTTCCTCATTTACGATATCTGAATACATCCAAGAATAATTTTCAGGAGAACCTGCCATCTTCTCTTGGTAACATGAATGGTATCCAATATATGGACCTATCTCGCAACAGTTTCCACGGGAATCTACCAAGAAGTTTTGTGAATGGTTGTTATTCCATGGCGATCTTGAAGCTGTCACATAACAAACTAAGTGGAGAGATTTTTCCAGAATCAACCAACTTTACTAATATATTGGGGTTGTTTATGGATAACAATCTCTTTACAGGAAAGATTGGACAAGGTTTGCGGAGCTTGATAAACTTGGAACTGCTTGACATGTCAAACAACAATCTCACTGGTGTTATTCCAAGTTGGATTGGCGAGCTTCCATCCTTAACTGCACTTCTGATTTCAGACAACTTCTTGAAAGGTGACATACCTATGTCGTTGTTCAACAAATCAAGTCTCCAGCTGCTAGACCTCTCAGCAAACAGTTTATCTGGGGTCATACCTCCACAGCATGATTCAAGAAACGGGGTTGTCTTACTCCTACAAGACAATAAGTTATCAGGTACTATTCCAGACACATTGCTTGCAAATGTAGAAATTCTTGATCTGAGAAACAACAGATTCTCTGGAAAGATTCCGGAGTTCATCAACATTCAAAATATTAGTATTCTTCTTCTACGGGGGAATAACTTTACAGGCCAGATTCCTCACCAGTTGTGTGGTCTAAGTAACATCCAACTTCTTGATCTTTCCAACAACAGATTGAATGGAACCATACCTTCATGTCTCAGTAATACATCATTTGGTTTTGGTAAAGAATGTACATCATATGATTATGATTTCGGCATTTCTTTCCCTTCTGATGTCTTCAATGGTTTTTCTCTGCATCAAGACTTCTCTTCCAACAAAAATGGTGGTATATATTTCAAATCTCTGCTTACGCTTGATCCGTTAAGTATGGACTACAAGGCAGCCACACAGACGAAAATCGAATTTGCAACAAAACACAGATATGATGCCTACATGGGTGGAAATCTCAAGTTATTGTTTGGAATGGATCTCTCAGAAAATGAGCTGAGTGGTGAGATACCAGTAGAGTTTGGAGGTCTTTTGGAACTACGAGCTCTAAATCTATCTCACAACAACTTATCAGGTGTGATACCAAAAAGCATTTCAAGTATGGAGAAAATGGAAAGCTTTGATCTTTCTTTCAACAGATTACAAGGCCGGATCCCATCACAACTAACAGAGCTGACCAGCCTCTCTGTATTCAAAGTCTCACACAACAACTTATCAGGAGTCATTCCACAGGGAAGACAGTTTAACACCTTTGATGCAGAAAGCTACTTTGGTAATCGTCTCCTCTGTGGACAACCAACCAACAGAAGCTGCAACAATAATAGCTATGAAGAAGCAGATAATGGAGTGGAAGCTGATGAATCCATAATCGACATGGTATCTTTCTACTTGAGTTTTGCTGCTGCTTATGTGACAATACTTATTGGAATATTGGCATCTCTATCTTTTGATTCTCCTTGGAGCAGATTTTGGTTCTACAAGGTTGATGCTTTCATCAAAAAGGTGAGGAATTTATTGTTGTAA


Protein sequences

Name Description Sequence
putative disease resistance protein; 46848-50365 putative disease resistance protein; 46848-50365 [Arabidopsis thaliana].

MGQLHGYKSCIDEEKIALFELRKHMISRTESESVLPTWTNDTTSDCCRWKGVACNRVSGRVTEISFGGLSLKDNSLLNLSLLHPFEDVRSLNLSSSRCSGLFDDVEGYKSLRKLRKLEILDLASNKFNNSIFHFLSAATSLTTLFLRSNNMDGSFPAKELRDLTNLELLDLSRNRFNGSIPIQGICELNNMQELDLSQNKLVGHLPSCLTSLTGLRVLDLSSNKLTGTVPSSLGSLQSLEYLSLFDNDFEGSFSFGSLANLSNLMVLKLCSKSSSLQVLSESSWKPKFQLSVIALRSCNMEKVPHFLLHQKDLRHVDLSDNNISGKLPSWLLANNTKLKVLLLQNNLFTSFQIPKSAHNLLFLDVSANDFNHLFPENIGWIFPHLRYLNTSKNNFQENLPSSLGNMNGIQYMDLSRNSFHGNLPRSFVNGCYSMAILKLSHNKLSGEIFPESTNFTNILGLFMDNNLFTGKIGQGLRSLINLELLDMSNNNLTGVIPSWIGELPSLTALLISDNFLKGDIPMSLFNKSSLQLLDLSANSLSGVIPPQHDSRNGVVLLLQDNKLSGTIPDTLLANVEILDLRNNRFSGKIPEFINIQNISILLLRGNNFTGQIPHQLCGLSNIQLLDLSNNRLNGTIPSCLSNTSFGFGKECTSYDYDFGISFPSDVFNGFSLHQDFSSNKNGGIYFKSLLTLDPLSMDYKAATQTKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVEFGGLLELRALNLSHNNLSGVIPKSISSMEKMESFDLSFNRLQGRIPSQLTELTSLSVFKVSHNNLSGVIPQGRQFNTFDAESYFGNRLLCGQPTNRSCNNNSYEEADNGVEADESIIDMVSFYLSFAAAYVTILIGILASLSFDSPWSRFWFYKVDAFIKKVRNLLL

putative disease resistance protein; 46848-50365 putative disease resistance protein; 46848-50365 [Arabidopsis thaliana].

MGQLHGYKSCIDEEKIALFELRKHMISRTESESVLPTWTNDTTSDCCRWKGVACNRVSGRVTEISFGGLSLKDNSLLNLSLLHPFEDVRSLNLSSSRCSGLFDDVEGYKSLRKLRKLEILDLASNKFNNSIFHFLSAATSLTTLFLRSNNMDGSFPAKELRDLTNLELLDLSRNRFNGSIPIQGICELNNMQELDLSQNKLVGHLPSCLTSLTGLRVLDLSSNKLTGTVPSSLGSLQSLEYLSLFDNDFEGSFSFGSLANLSNLMVLKLCSKSSSLQVLSESSWKPKFQLSVIALRSCNMEKVPHFLLHQKDLRHVDLSDNNISGKLPSWLLANNTKLKVLLLQNNLFTSFQIPKSAHNLLFLDVSANDFNHLFPENIGWIFPHLRYLNTSKNNFQENLPSSLGNMNGIQYMDLSRNSFHGNLPRSFVNGCYSMAILKLSHNKLSGEIFPESTNFTNILGLFMDNNLFTGKIGQGLRSLINLELLDMSNNNLTGVIPSWIGELPSLTALLISDNFLKGDIPMSLFNKSSLQLLDLSANSLSGVIPPQHDSRNGVVLLLQDNKLSGTIPDTLLANVEILDLRNNRFSGKIPEFINIQNISILLLRGNNFTGQIPHQLCGLSNIQLLDLSNNRLNGTIPSCLSNTSFGFGKECTSYDYDFGISFPSDVFNGFSLHQDFSSNKNGGIYFKSLLTLDPLSMDYKAATQTKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVEFGGLLELRALNLSHNNLSGVIPKSISSMEKMESFDLSFNRLQGRIPSQLTELTSLSVFKVSHNNLSGVIPQGRQFNTFDAESYFGNRLLCGQPTNRSCNNNSYEEADNGVEADESIIDMVSFYLSFAAAYVTILIGILASLSFDSPWSRFWFYKVDAFIKKVRNLLL


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
1-894 PTHR24420:SF473,SUBFAMILY NOT NAMED

MGQLHGYKSCIDEEKIALFELRKHMISRTESESVLPTWTNDTTSDCCRWKGVACNRVSGRVTEISFGGLSLKDNSLLNLSLLHPFEDVRSLNLSSSRCSGLFDDVEGYKSLRKLRKLEILDLASNKFNNSIFHFLSAATSLTTLFLRSNNMDGSFPAKELRDLTNLELLDLSRNRFNGSIPIQGICELNNMQELDLSQNKLVGHLPSCLTSLTGLRVLDLSSNKLTGTVPSSLGSLQSLEYLSLFDNDFEGSFSFGSLANLSNLMVLKLCSKSSSLQVLSESSWKPKFQLSVIALRSCNMEKVPHFLLHQKDLRHVDLSDNNISGKLPSWLLANNTKLKVLLLQNNLFTSFQIPKSAHNLLFLDVSANDFNHLFPENIGWIFPHLRYLNTSKNNFQENLPSSLGNMNGIQYMDLSRNSFHGNLPRSFVNGCYSMAILKLSHNKLSGEIFPESTNFTNILGLFMDNNLFTGKIGQGLRSLINLELLDMSNNNLTGVIPSWIGELPSLTALLISDNFLKGDIPMSLFNKSSLQLLDLSANSLSGVIPPQHDSRNGVVLLLQDNKLSGTIPDTLLANVEILDLRNNRFSGKIPEFINIQNISILLLRGNNFTGQIPHQLCGLSNIQLLDLSNNRLNGTIPSCLSNTSFGFGKECTSYDYDFGISFPSDVFNGFSLHQDFSSNKNGGIYFKSLLTLDPLSMDYKAATQTKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVEFGGLLELRALNLSHNNLSGVIPKSISSMEKMESFDLSFNRLQGRIPSQLTELTSLSVFKVSHNNLSGVIPQGRQFNTFDAESYFGNRLLCGQPTNRSCNNNSYEEADNGVEADESIIDMVSFYLSFAAAYVTILIGILASLSFDSPWSRFW

HMMPanther: PTHR24420
1-894 PTHR24420,FAMILY NOT NAMED

MGQLHGYKSCIDEEKIALFELRKHMISRTESESVLPTWTNDTTSDCCRWKGVACNRVSGRVTEISFGGLSLKDNSLLNLSLLHPFEDVRSLNLSSSRCSGLFDDVEGYKSLRKLRKLEILDLASNKFNNSIFHFLSAATSLTTLFLRSNNMDGSFPAKELRDLTNLELLDLSRNRFNGSIPIQGICELNNMQELDLSQNKLVGHLPSCLTSLTGLRVLDLSSNKLTGTVPSSLGSLQSLEYLSLFDNDFEGSFSFGSLANLSNLMVLKLCSKSSSLQVLSESSWKPKFQLSVIALRSCNMEKVPHFLLHQKDLRHVDLSDNNISGKLPSWLLANNTKLKVLLLQNNLFTSFQIPKSAHNLLFLDVSANDFNHLFPENIGWIFPHLRYLNTSKNNFQENLPSSLGNMNGIQYMDLSRNSFHGNLPRSFVNGCYSMAILKLSHNKLSGEIFPESTNFTNILGLFMDNNLFTGKIGQGLRSLINLELLDMSNNNLTGVIPSWIGELPSLTALLISDNFLKGDIPMSLFNKSSLQLLDLSANSLSGVIPPQHDSRNGVVLLLQDNKLSGTIPDTLLANVEILDLRNNRFSGKIPEFINIQNISILLLRGNNFTGQIPHQLCGLSNIQLLDLSNNRLNGTIPSCLSNTSFGFGKECTSYDYDFGISFPSDVFNGFSLHQDFSSNKNGGIYFKSLLTLDPLSMDYKAATQTKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVEFGGLLELRALNLSHNNLSGVIPKSISSMEKMESFDLSFNRLQGRIPSQLTELTSLSVFKVSHNNLSGVIPQGRQFNTFDAESYFGNRLLCGQPTNRSCNNNSYEEADNGVEADESIIDMVSFYLSFAAAYVTILIGILASLSFDSPWSRFW

HMMPanther: PTHR24420:SF473
1-894 PTHR24420:SF473,SUBFAMILY NOT NAMED

MGQLHGYKSCIDEEKIALFELRKHMISRTESESVLPTWTNDTTSDCCRWKGVACNRVSGRVTEISFGGLSLKDNSLLNLSLLHPFEDVRSLNLSSSRCSGLFDDVEGYKSLRKLRKLEILDLASNKFNNSIFHFLSAATSLTTLFLRSNNMDGSFPAKELRDLTNLELLDLSRNRFNGSIPIQGICELNNMQELDLSQNKLVGHLPSCLTSLTGLRVLDLSSNKLTGTVPSSLGSLQSLEYLSLFDNDFEGSFSFGSLANLSNLMVLKLCSKSSSLQVLSESSWKPKFQLSVIALRSCNMEKVPHFLLHQKDLRHVDLSDNNISGKLPSWLLANNTKLKVLLLQNNLFTSFQIPKSAHNLLFLDVSANDFNHLFPENIGWIFPHLRYLNTSKNNFQENLPSSLGNMNGIQYMDLSRNSFHGNLPRSFVNGCYSMAILKLSHNKLSGEIFPESTNFTNILGLFMDNNLFTGKIGQGLRSLINLELLDMSNNNLTGVIPSWIGELPSLTALLISDNFLKGDIPMSLFNKSSLQLLDLSANSLSGVIPPQHDSRNGVVLLLQDNKLSGTIPDTLLANVEILDLRNNRFSGKIPEFINIQNISILLLRGNNFTGQIPHQLCGLSNIQLLDLSNNRLNGTIPSCLSNTSFGFGKECTSYDYDFGISFPSDVFNGFSLHQDFSSNKNGGIYFKSLLTLDPLSMDYKAATQTKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVEFGGLLELRALNLSHNNLSGVIPKSISSMEKMESFDLSFNRLQGRIPSQLTELTSLSVFKVSHNNLSGVIPQGRQFNTFDAESYFGNRLLCGQPTNRSCNNNSYEEADNGVEADESIIDMVSFYLSFAAAYVTILIGILASLSFDSPWSRFW

HMMPanther: PTHR24420
1-894 PTHR24420,FAMILY NOT NAMED

MGQLHGYKSCIDEEKIALFELRKHMISRTESESVLPTWTNDTTSDCCRWKGVACNRVSGRVTEISFGGLSLKDNSLLNLSLLHPFEDVRSLNLSSSRCSGLFDDVEGYKSLRKLRKLEILDLASNKFNNSIFHFLSAATSLTTLFLRSNNMDGSFPAKELRDLTNLELLDLSRNRFNGSIPIQGICELNNMQELDLSQNKLVGHLPSCLTSLTGLRVLDLSSNKLTGTVPSSLGSLQSLEYLSLFDNDFEGSFSFGSLANLSNLMVLKLCSKSSSLQVLSESSWKPKFQLSVIALRSCNMEKVPHFLLHQKDLRHVDLSDNNISGKLPSWLLANNTKLKVLLLQNNLFTSFQIPKSAHNLLFLDVSANDFNHLFPENIGWIFPHLRYLNTSKNNFQENLPSSLGNMNGIQYMDLSRNSFHGNLPRSFVNGCYSMAILKLSHNKLSGEIFPESTNFTNILGLFMDNNLFTGKIGQGLRSLINLELLDMSNNNLTGVIPSWIGELPSLTALLISDNFLKGDIPMSLFNKSSLQLLDLSANSLSGVIPPQHDSRNGVVLLLQDNKLSGTIPDTLLANVEILDLRNNRFSGKIPEFINIQNISILLLRGNNFTGQIPHQLCGLSNIQLLDLSNNRLNGTIPSCLSNTSFGFGKECTSYDYDFGISFPSDVFNGFSLHQDFSSNKNGGIYFKSLLTLDPLSMDYKAATQTKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVEFGGLLELRALNLSHNNLSGVIPKSISSMEKMESFDLSFNRLQGRIPSQLTELTSLSVFKVSHNNLSGVIPQGRQFNTFDAESYFGNRLLCGQPTNRSCNNNSYEEADNGVEADESIIDMVSFYLSFAAAYVTILIGILASLSFDSPWSRFW

Gene3D: G3DSA:3.80.10.10
12-298 G3DSA:3.80.10.10

DEEKIALFELRKHMISRTESESVLPTWTNDTTSDCCRWKGVACNRVSGRVTEISFGGLSLKDNSLLNLSLLHPFEDVRSLNLSSSRCSGLFDDVEGYKSLRKLRKLEILDLASNKFNNSIFHFLSAATSLTTLFLRSNNMDGSFPAKELRDLTNLELLDLSRNRFNGSIPIQGICELNNMQELDLSQNKLVGHLPSCLTSLTGLRVLDLSSNKLTGTVPSSLGSLQSLEYLSLFDNDFEGSFSFGSLANLSNLMVLKLCSKSSSLQVLSESSWKPKFQLSVIALRSC

HMMPfam: PF08263
IPR013210
12-55 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DEEKIALFELRKHMISRTESESVLPTWTNDTTSDCCRWKGVACN

Gene3D: G3DSA:3.80.10.10
12-298 G3DSA:3.80.10.10

DEEKIALFELRKHMISRTESESVLPTWTNDTTSDCCRWKGVACNRVSGRVTEISFGGLSLKDNSLLNLSLLHPFEDVRSLNLSSSRCSGLFDDVEGYKSLRKLRKLEILDLASNKFNNSIFHFLSAATSLTTLFLRSNNMDGSFPAKELRDLTNLELLDLSRNRFNGSIPIQGICELNNMQELDLSQNKLVGHLPSCLTSLTGLRVLDLSSNKLTGTVPSSLGSLQSLEYLSLFDNDFEGSFSFGSLANLSNLMVLKLCSKSSSLQVLSESSWKPKFQLSVIALRSC

HMMPfam: PF08263
IPR013210
12-55 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DEEKIALFELRKHMISRTESESVLPTWTNDTTSDCCRWKGVACN

superfamily: SSF52047
68-396 SSF52047,LRR

GLSLKDNSLLNLSLLHPFEDVRSLNLSSSRCSGLFDDVEGYKSLRKLRKLEILDLASNKFNNSIFHFLSAATSLTTLFLRSNNMDGSFPAKELRDLTNLELLDLSRNRFNGSIPIQGICELNNMQELDLSQNKLVGHLPSCLTSLTGLRVLDLSSNKLTGTVPSSLGSLQSLEYLSLFDNDFEGSFSFGSLANLSNLMVLKLCSKSSSLQVLSESSWKPKFQLSVIALRSCNMEKVPHFLLHQKDLRHVDLSDNNISGKLPSWLLANNTKLKVLLLQNNLFTSFQIPKSAHNLLFLDVSANDFNHLFPENIGWIFPHLRYLNTSKNNFQ

superfamily: SSF52047
68-396 SSF52047,LRR

GLSLKDNSLLNLSLLHPFEDVRSLNLSSSRCSGLFDDVEGYKSLRKLRKLEILDLASNKFNNSIFHFLSAATSLTTLFLRSNNMDGSFPAKELRDLTNLELLDLSRNRFNGSIPIQGICELNNMQELDLSQNKLVGHLPSCLTSLTGLRVLDLSSNKLTGTVPSSLGSLQSLEYLSLFDNDFEGSFSFGSLANLSNLMVLKLCSKSSSLQVLSESSWKPKFQLSVIALRSCNMEKVPHFLLHQKDLRHVDLSDNNISGKLPSWLLANNTKLKVLLLQNNLFTSFQIPKSAHNLLFLDVSANDFNHLFPENIGWIFPHLRYLNTSKNNFQ

HMMPfam: PF00560
IPR001611
165-185 LRR_1
Leucine-rich repeat

NLELLDLSRNRFNGSIPIQGI

HMMPfam: PF00560
IPR001611
165-185 LRR_1
Leucine-rich repeat

NLELLDLSRNRFNGSIPIQGI

HMMPfam: PF13855
190-248 LRR_8,Leucine rich repeat

NMQELDLSQNKLVGHLPSCLTSLTGLRVLDLSSNKLTGTVPSSLGSLQSLEYLSLFDND

HMMPfam: PF13855
190-248 LRR_8,Leucine rich repeat

NMQELDLSQNKLVGHLPSCLTSLTGLRVLDLSSNKLTGTVPSSLGSLQSLEYLSLFDND

FPrintScan: PR00019
215-228 LEURICHRPT,Leucine-rich repeat signature

LRVLDLSSNKLTGT

FPrintScan: PR00019
215-228 LEURICHRPT,Leucine-rich repeat signature

LRVLDLSSNKLTGT

Gene3D: G3DSA:3.80.10.10
299-437 G3DSA:3.80.10.10

NMEKVPHFLLHQKDLRHVDLSDNNISGKLPSWLLANNTKLKVLLLQNNLFTSFQIPKSAHNLLFLDVSANDFNHLFPENIGWIFPHLRYLNTSKNNFQENLPSSLGNMNGIQYMDLSRNSFHGNLPRSFVNGCYSMAIL

Gene3D: G3DSA:3.80.10.10
299-437 G3DSA:3.80.10.10

NMEKVPHFLLHQKDLRHVDLSDNNISGKLPSWLLANNTKLKVLLLQNNLFTSFQIPKSAHNLLFLDVSANDFNHLFPENIGWIFPHLRYLNTSKNNFQENLPSSLGNMNGIQYMDLSRNSFHGNLPRSFVNGCYSMAIL

HMMPfam: PF00560
IPR001611
313-334 LRR_1
Leucine-rich repeat

LRHVDLSDNNISGKLPSWLLAN

HMMPfam: PF00560
IPR001611
313-334 LRR_1
Leucine-rich repeat

LRHVDLSDNNISGKLPSWLLAN

superfamily: SSF52047
398-857 SSF52047,LRR

NLPSSLGNMNGIQYMDLSRNSFHGNLPRSFVNGCYSMAILKLSHNKLSGEIFPESTNFTNILGLFMDNNLFTGKIGQGLRSLINLELLDMSNNNLTGVIPSWIGELPSLTALLISDNFLKGDIPMSLFNKSSLQLLDLSANSLSGVIPPQHDSRNGVVLLLQDNKLSGTIPDTLLANVEILDLRNNRFSGKIPEFINIQNISILLLRGNNFTGQIPHQLCGLSNIQLLDLSNNRLNGTIPSCLSNTSFGFGKECTSYDYDFGISFPSDVFNGFSLHQDFSSNKNGGIYFKSLLTLDPLSMDYKAATQTKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVEFGGLLELRALNLSHNNLSGVIPKSISSMEKMESFDLSFNRLQGRIPSQLTELTSLSVFKVSHNNLSGVIPQGRQFNTFDAESYFGNRLLCGQPTNRSCNNNSYEEADNGVEADE

superfamily: SSF52047
398-857 SSF52047,LRR

NLPSSLGNMNGIQYMDLSRNSFHGNLPRSFVNGCYSMAILKLSHNKLSGEIFPESTNFTNILGLFMDNNLFTGKIGQGLRSLINLELLDMSNNNLTGVIPSWIGELPSLTALLISDNFLKGDIPMSLFNKSSLQLLDLSANSLSGVIPPQHDSRNGVVLLLQDNKLSGTIPDTLLANVEILDLRNNRFSGKIPEFINIQNISILLLRGNNFTGQIPHQLCGLSNIQLLDLSNNRLNGTIPSCLSNTSFGFGKECTSYDYDFGISFPSDVFNGFSLHQDFSSNKNGGIYFKSLLTLDPLSMDYKAATQTKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVEFGGLLELRALNLSHNNLSGVIPKSISSMEKMESFDLSFNRLQGRIPSQLTELTSLSVFKVSHNNLSGVIPQGRQFNTFDAESYFGNRLLCGQPTNRSCNNNSYEEADNGVEADE

Gene3D: G3DSA:3.80.10.10
438-545 G3DSA:3.80.10.10

KLSHNKLSGEIFPESTNFTNILGLFMDNNLFTGKIGQGLRSLINLELLDMSNNNLTGVIPSWIGELPSLTALLISDNFLKGDIPMSLFNKSSLQLLDLSANSLSGVIP

Gene3D: G3DSA:3.80.10.10
438-545 G3DSA:3.80.10.10

KLSHNKLSGEIFPESTNFTNILGLFMDNNLFTGKIGQGLRSLINLELLDMSNNNLTGVIPSWIGELPSLTALLISDNFLKGDIPMSLFNKSSLQLLDLSANSLSGVIP

HMMPfam: PF13855
481-540 LRR_8,Leucine rich repeat

NLELLDMSNNNLTGVIPSWIGELPSLTALLISDNFLKGDIPMSLFNKSSLQLLDLSANSL

HMMPfam: PF13855
481-540 LRR_8,Leucine rich repeat

NLELLDMSNNNLTGVIPSWIGELPSLTALLISDNFLKGDIPMSLFNKSSLQLLDLSANSL

Gene3D: G3DSA:3.80.10.10
556-647 G3DSA:3.80.10.10

LLLQDNKLSGTIPDTLLANVEILDLRNNRFSGKIPEFINIQNISILLLRGNNFTGQIPHQLCGLSNIQLLDLSNNRLNGTIPSCLSNTSFGF

Gene3D: G3DSA:3.80.10.10
556-647 G3DSA:3.80.10.10

LLLQDNKLSGTIPDTLLANVEILDLRNNRFSGKIPEFINIQNISILLLRGNNFTGQIPHQLCGLSNIQLLDLSNNRLNGTIPSCLSNTSFGF

HMMPfam: PF00560
IPR001611
574-592 LRR_1
Leucine-rich repeat

NVEILDLRNNRFSGKIPEF

HMMPfam: PF00560
IPR001611
574-592 LRR_1
Leucine-rich repeat

NVEILDLRNNRFSGKIPEF

FPrintScan: PR00019
619-632 LEURICHRPT,Leucine-rich repeat signature

LSNIQLLDLSNNRL

FPrintScan: PR00019
619-632 LEURICHRPT,Leucine-rich repeat signature

LSNIQLLDLSNNRL

HMMPfam: PF00560
IPR001611
621-641 LRR_1
Leucine-rich repeat

NIQLLDLSNNRLNGTIPSCLS

HMMPfam: PF00560
IPR001611
621-641 LRR_1
Leucine-rich repeat

NIQLLDLSNNRLNGTIPSCLS

Gene3D: G3DSA:3.80.10.10
729-836 G3DSA:3.80.10.10

MDLSENELSGEIPVEFGGLLELRALNLSHNNLSGVIPKSISSMEKMESFDLSFNRLQGRIPSQLTELTSLSVFKVSHNNLSGVIPQGRQFNTFDAESYFGNRLLCGQP

Gene3D: G3DSA:3.80.10.10
729-836 G3DSA:3.80.10.10

MDLSENELSGEIPVEFGGLLELRALNLSHNNLSGVIPKSISSMEKMESFDLSFNRLQGRIPSQLTELTSLSVFKVSHNNLSGVIPQGRQFNTFDAESYFGNRLLCGQP

HMMPfam: PF13855
750-808 LRR_8,Leucine rich repeat

LRALNLSHNNLSGVIPKSISSMEKMESFDLSFNRLQGRIPSQLTELTSLSVFKVSHNNL

HMMPfam: PF13855
750-808 LRR_8,Leucine rich repeat

LRALNLSHNNLSGVIPKSISSMEKMESFDLSFNRLQGRIPSQLTELTSLSVFKVSHNNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox