PRGDB00062165 (disease resistance protein, putative; 11609-15699)

From PRG Wiki
Jump to: navigation, search
disease resistance protein, putative; 11609-15699
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 9989658 (AC079678)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 1 BAC F9E11 genomic sequence, complete sequence.

DNA Sequence

ATGGAGGGGAAGCTTTTCTTGGGACAATACTTGATATGTGTGATTTTACTGTTGGGGCAGCTACATGGATACAAAAGCTGTATTGAGAAAGAAAGGAAGGCTTTGTTGGAGCTCAAAGCATTTCTGATCCCATTGAATGCAGGAGAATGGAACGACAATGTTCTTAGTTGGACCAATGACACAAAGAGTGATTGTTGCCAGTGGATGGGGGTTGAGTGCAATCGTAAAAGTGGGCGGATTACCAACATTGCCTTTGGTATAGGATTCATTATAGAGAACCCTCTCCTAAATCTTTCTCTGTTGCATCCCTTTGAAGATGTTAGAAGTCTGGACTTATCATCCTCTCGTTCGTGCGAAGACTGTGGATTCAGTGGCTTGTTTGATGACGTTGAAGGTTACAAAAGCCTCAGTAGATTAAGAAACCTGGAGATTCTGGATCTCTCTTCACATAGATTCAACAACAGCATCTTTCCTTTTCTTAATGCCGCTACATCCCTTACAACTCTTTTTCTTACGTACAACAACATGCATAGCCCATTTCTTGTTAAAGAATTCAAAGATTTAACAAATTTGGAACATCTAGACTTGCGTGGAAACAGATTTAATGGCTCCATACCAACACAAGATTATAACAGCCTAAGGAGATTTAGAAAGCTGGAGATTCTGGATCTCTCTGATAATTTATTCAATAGCAGGATCTTTCCCTTCCTTAATTCTGCTACATCACTTAAATCTCTGTCTCTTTGGGGAAACAACATGGGTGGCCCTTTTCCTGCTAAAGAACTTAGAGATTTGACAAACGTGGAACTGCTGGACCTGAGTAGAAACAGATTTAACGGCTCCATACCAGTACGAGCTTTATTTGCCCTGAGGAAGCTGAAAGCCCTGGATCTAAGCGATAATGAATTTTCAAGCTCAGTGGAATTGCAAGGCAAGTTTGCTAAAACAAAACCCCTTTCTGGGACTTGCCCATGGAAAAATATGGAAGAGCTCAAACTCAGTAACAACAAACTAGCTGGTCAGTTTCCTCTATGTTTAACTAGCTTGACTGGACTTCGAGTTCTTGATCTTTCATCAAATCAATTGACTGGGAACGTACCCTCTGCTCTCGCTAACCTTGAATCCCTTGAGTACCTATCACTGTTTGGTAACAACTTCGAAGGCTTCTTCTCACTTGGTTTACTCGCCAACCTCTCAAAACTTAAGGTGCTCAGACTTGATTCACAATCCAACTCACTTGAAGTAGAGTTTGAAACGTCTTGGAAGCCAAAATTCCAATTGGTAGTTATTGCGCTACGATCTTGCAACTTGGAGAAGGTTCCTCATTTTCTCCTACATCAAAAGGATTTGCATCACGTTGATCTCTCTGACAATCAAATTCATGGAAATTTTCCTTCTTGGCTGTTAGAGAACAATACGAAACTCGAGGTTTTGCTTCTACAGAATAATTCTTTTACGAGCTTTCAGCTACCGAAATCTGCTCATAACCTGCTTTTCCTGAACGTGTCAGTCAACAAATTCAATCATCTCTTTCTTCAGAACTTTGGGTGGATACTCCCTCATTTAGTCTGTGTGAATTTAGCCTATAATGGTTTTCAAGGAAATCTGCCATCTTCTCTGGATAACATGAAGAGTATTGAATTTCTAGATTTGTCTCACAACAGGTTCCACGGGAAGCTACCAAGAAGATTTTTAAAGGGTTGTTATAACTTAACAATCTTGAAGCTGTCACACAACAAACTAAGTGGAGAGGTTTTTCCAGAAGCAGCCAACTTTACTCGTTTATGGGTGATGTCTATGGATAACAATCTGTTTACAGGAAATATTGGAAAAGGTTTTCGGAGCCTACCATCTTTGAATGTACTTGACATTTCAAACAACAAACTCACAGGTGTTATTCCAAGTTGGATTGGCGAACGTCAGGGATTATTCGCACTGCAGCTTTCAAACAACATGTTGGAAGGTGAAATACCTACTTCCTTGTTCAACATATCCTATCTTCAGCTACTGGACCTCTCTTCAAACAGGTTATCTGGGGATATACCTCCGCACGTAAGTTCCATATATCATGGGGCAGTGTTACTCCTCCAAAACAATAATTTATCAGGGGTTATTCCAGACACACTACTACTGAATGTTATTGTACTTGATCTGAGAAATAACCGACTGTCTGGGAATCTTCCGGAGTTCATCAACACCCAAAACATCAGTATTCTTCTTTTGCGGGGGAACAATTTTACAGGACAGATTCCTCACCAGTTCTGCAGTCTAAGTAACATCCAACTTCTGGATCTTTCCAACAACAAATTCAATGGATCGATACCATCATGTCTTAGCAATACATCATTTGGTTTGAGGAAAGGGGATGATTCTTATAGATATGATGTCCCTTCAAGATTTGGCACAGCTAAGGATCCTGTATATTTTGAATCTCTACTCATGATAGATGAATTTAATATGGTCAATGAAACCAACTCCCAGACGAAAATTGAATTTGCAACAAAGCACAGGTATGATGCCTACATGGGTGGAAATCTCAAATTATTGTTTGGAATGGATCTCTCAGAAAATGAGCTGAGTGGTGAGATCCCGGTAGAGCTTGGAGGTCTTGTGGAATTAGAAGCTCTCAATCTTTCTCACAACAACTTATCAGGAGTGATACTAGAAAGCTTTTCAGGTCTGAAGAATGTGGAAAGCCTTGATCTTTCTTTCAACAGATTACAAGGTCCTATCCCACTACAACTTACAGATATGATCAGCCTTGCTGTGTTCAATGTCTCCTACAACAACTTATCAGGAATCGTTCCACAGGGAAGACAGTTTAACACCTTTGAGACACAAAGCTACTTTGGTAATCCTCTTCTCTGTGGGAAGTCCATAGACATAAGCTGCGCGAGCAATAACTTTCACCCAACAGATAATGGAGTGGAAGCTGATGAATCTACAGTCGACATGGAATCTTTCTACTGGAGTTTTGTTGCAGCCTATGTGACAATACTTCTTGGAATACTTGCATCTCTCTCATTTGATTCTCCTTGGAGCAGAGCTTGGTTCTACATCGTTGATGCTTTCGTCCTCAAGGTTAGGAATATGTTGTGGCAAAACACTGCAGGTACCAAATGTTCTTACGTGCTAGTTTCATTGTCGTCCCCATCTGTTGTTGTTCTTCTCAAACCTCCTGCTTTGTTTCACAAAACCAGAACATAA


Protein sequences

Name Description Sequence
disease resistance protein, putative; 11609-15699 disease resistance protein, putative; 11609-15699 [Arabidopsis thaliana].

MEGKLFLGQYLICVILLLGQLHGYKSCIEKERKALLELKAFLIPLNAGEWNDNVLSWTNDTKSDCCQWMGVECNRKSGRITNIAFGIGFIIENPLLNLSLLHPFEDVRSLDLSSSRSCEDCGFSGLFDDVEGYKSLSRLRNLEILDLSSHRFNNSIFPFLNAATSLTTLFLTYNNMHSPFLVKEFKDLTNLEHLDLRGNRFNGSIPTQDYNSLRRFRKLEILDLSDNLFNSRIFPFLNSATSLKSLSLWGNNMGGPFPAKELRDLTNVELLDLSRNRFNGSIPVRALFALRKLKALDLSDNEFSSSVELQGKFAKTKPLSGTCPWKNMEELKLSNNKLAGQFPLCLTSLTGLRVLDLSSNQLTGNVPSALANLESLEYLSLFGNNFEGFFSLGLLANLSKLKVLRLDSQSNSLEVEFETSWKPKFQLVVIALRSCNLEKVPHFLLHQKDLHHVDLSDNQIHGNFPSWLLENNTKLEVLLLQNNSFTSFQLPKSAHNLLFLNVSVNKFNHLFLQNFGWILPHLVCVNLAYNGFQGNLPSSLDNMKSIEFLDLSHNRFHGKLPRRFLKGCYNLTILKLSHNKLSGEVFPEAANFTRLWVMSMDNNLFTGNIGKGFRSLPSLNVLDISNNKLTGVIPSWIGERQGLFALQLSNNMLEGEIPTSLFNISYLQLLDLSSNRLSGDIPPHVSSIYHGAVLLLQNNNLSGVIPDTLLLNVIVLDLRNNRLSGNLPEFINTQNISILLLRGNNFTGQIPHQFCSLSNIQLLDLSNNKFNGSIPSCLSNTSFGLRKGDDSYRYDVPSRFGTAKDPVYFESLLMIDEFNMVNETNSQTKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVELGGLVELEALNLSHNNLSGVILESFSGLKNVESLDLSFNRLQGPIPLQLTDMISLAVFNVSYNNLSGIVPQGRQFNTFETQSYFGNPLLCGKSIDISCASNNFHPTDNGVEADESTVDMESFYWSFVAAYVTILLGILASLSFDSPWSRAWFYIVDAFVLKVRNMLWQNTAGTKCSYVLVSLSSPSVVVLLKPPALFHKTRT

disease resistance protein, putative; 11609-15699 disease resistance protein, putative; 11609-15699 [Arabidopsis thaliana].

MEGKLFLGQYLICVILLLGQLHGYKSCIEKERKALLELKAFLIPLNAGEWNDNVLSWTNDTKSDCCQWMGVECNRKSGRITNIAFGIGFIIENPLLNLSLLHPFEDVRSLDLSSSRSCEDCGFSGLFDDVEGYKSLSRLRNLEILDLSSHRFNNSIFPFLNAATSLTTLFLTYNNMHSPFLVKEFKDLTNLEHLDLRGNRFNGSIPTQDYNSLRRFRKLEILDLSDNLFNSRIFPFLNSATSLKSLSLWGNNMGGPFPAKELRDLTNVELLDLSRNRFNGSIPVRALFALRKLKALDLSDNEFSSSVELQGKFAKTKPLSGTCPWKNMEELKLSNNKLAGQFPLCLTSLTGLRVLDLSSNQLTGNVPSALANLESLEYLSLFGNNFEGFFSLGLLANLSKLKVLRLDSQSNSLEVEFETSWKPKFQLVVIALRSCNLEKVPHFLLHQKDLHHVDLSDNQIHGNFPSWLLENNTKLEVLLLQNNSFTSFQLPKSAHNLLFLNVSVNKFNHLFLQNFGWILPHLVCVNLAYNGFQGNLPSSLDNMKSIEFLDLSHNRFHGKLPRRFLKGCYNLTILKLSHNKLSGEVFPEAANFTRLWVMSMDNNLFTGNIGKGFRSLPSLNVLDISNNKLTGVIPSWIGERQGLFALQLSNNMLEGEIPTSLFNISYLQLLDLSSNRLSGDIPPHVSSIYHGAVLLLQNNNLSGVIPDTLLLNVIVLDLRNNRLSGNLPEFINTQNISILLLRGNNFTGQIPHQFCSLSNIQLLDLSNNKFNGSIPSCLSNTSFGLRKGDDSYRYDVPSRFGTAKDPVYFESLLMIDEFNMVNETNSQTKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVELGGLVELEALNLSHNNLSGVILESFSGLKNVESLDLSFNRLQGPIPLQLTDMISLAVFNVSYNNLSGIVPQGRQFNTFETQSYFGNPLLCGKSIDISCASNNFHPTDNGVEADESTVDMESFYWSFVAAYVTILLGILASLSFDSPWSRAWFYIVDAFVLKVRNMLWQNTAGTKCSYVLVSLSSPSVVVLLKPPALFHKTRT


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
1-1017 PTHR24420:SF473,SUBFAMILY NOT NAMED

MEGKLFLGQYLICVILLLGQLHGYKSCIEKERKALLELKAFLIPLNAGEWNDNVLSWTNDTKSDCCQWMGVECNRKSGRITNIAFGIGFIIENPLLNLSLLHPFEDVRSLDLSSSRSCEDCGFSGLFDDVEGYKSLSRLRNLEILDLSSHRFNNSIFPFLNAATSLTTLFLTYNNMHSPFLVKEFKDLTNLEHLDLRGNRFNGSIPTQDYNSLRRFRKLEILDLSDNLFNSRIFPFLNSATSLKSLSLWGNNMGGPFPAKELRDLTNVELLDLSRNRFNGSIPVRALFALRKLKALDLSDNEFSSSVELQGKFAKTKPLSGTCPWKNMEELKLSNNKLAGQFPLCLTSLTGLRVLDLSSNQLTGNVPSALANLESLEYLSLFGNNFEGFFSLGLLANLSKLKVLRLDSQSNSLEVEFETSWKPKFQLVVIALRSCNLEKVPHFLLHQKDLHHVDLSDNQIHGNFPSWLLENNTKLEVLLLQNNSFTSFQLPKSAHNLLFLNVSVNKFNHLFLQNFGWILPHLVCVNLAYNGFQGNLPSSLDNMKSIEFLDLSHNRFHGKLPRRFLKGCYNLTILKLSHNKLSGEVFPEAANFTRLWVMSMDNNLFTGNIGKGFRSLPSLNVLDISNNKLTGVIPSWIGERQGLFALQLSNNMLEGEIPTSLFNISYLQLLDLSSNRLSGDIPPHVSSIYHGAVLLLQNNNLSGVIPDTLLLNVIVLDLRNNRLSGNLPEFINTQNISILLLRGNNFTGQIPHQFCSLSNIQLLDLSNNKFNGSIPSCLSNTSFGLRKGDDSYRYDVPSRFGTAKDPVYFESLLMIDEFNMVNETNSQTKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVELGGLVELEALNLSHNNLSGVILESFSGLKNVESLDLSFNRLQGPIPLQLTDMISLAVFNVSYNNLSGIVPQGRQFNTFETQSYFGNPLLCGKSIDISCASNNFHPTDNGVEADESTVDMESFYWSFVAAYVTILLGILASLSFDSPWSRAW

HMMPanther: PTHR24420
1-1017 PTHR24420,FAMILY NOT NAMED

MEGKLFLGQYLICVILLLGQLHGYKSCIEKERKALLELKAFLIPLNAGEWNDNVLSWTNDTKSDCCQWMGVECNRKSGRITNIAFGIGFIIENPLLNLSLLHPFEDVRSLDLSSSRSCEDCGFSGLFDDVEGYKSLSRLRNLEILDLSSHRFNNSIFPFLNAATSLTTLFLTYNNMHSPFLVKEFKDLTNLEHLDLRGNRFNGSIPTQDYNSLRRFRKLEILDLSDNLFNSRIFPFLNSATSLKSLSLWGNNMGGPFPAKELRDLTNVELLDLSRNRFNGSIPVRALFALRKLKALDLSDNEFSSSVELQGKFAKTKPLSGTCPWKNMEELKLSNNKLAGQFPLCLTSLTGLRVLDLSSNQLTGNVPSALANLESLEYLSLFGNNFEGFFSLGLLANLSKLKVLRLDSQSNSLEVEFETSWKPKFQLVVIALRSCNLEKVPHFLLHQKDLHHVDLSDNQIHGNFPSWLLENNTKLEVLLLQNNSFTSFQLPKSAHNLLFLNVSVNKFNHLFLQNFGWILPHLVCVNLAYNGFQGNLPSSLDNMKSIEFLDLSHNRFHGKLPRRFLKGCYNLTILKLSHNKLSGEVFPEAANFTRLWVMSMDNNLFTGNIGKGFRSLPSLNVLDISNNKLTGVIPSWIGERQGLFALQLSNNMLEGEIPTSLFNISYLQLLDLSSNRLSGDIPPHVSSIYHGAVLLLQNNNLSGVIPDTLLLNVIVLDLRNNRLSGNLPEFINTQNISILLLRGNNFTGQIPHQFCSLSNIQLLDLSNNKFNGSIPSCLSNTSFGLRKGDDSYRYDVPSRFGTAKDPVYFESLLMIDEFNMVNETNSQTKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVELGGLVELEALNLSHNNLSGVILESFSGLKNVESLDLSFNRLQGPIPLQLTDMISLAVFNVSYNNLSGIVPQGRQFNTFETQSYFGNPLLCGKSIDISCASNNFHPTDNGVEADESTVDMESFYWSFVAAYVTILLGILASLSFDSPWSRAW

HMMPanther: PTHR24420:SF473
1-1017 PTHR24420:SF473,SUBFAMILY NOT NAMED

MEGKLFLGQYLICVILLLGQLHGYKSCIEKERKALLELKAFLIPLNAGEWNDNVLSWTNDTKSDCCQWMGVECNRKSGRITNIAFGIGFIIENPLLNLSLLHPFEDVRSLDLSSSRSCEDCGFSGLFDDVEGYKSLSRLRNLEILDLSSHRFNNSIFPFLNAATSLTTLFLTYNNMHSPFLVKEFKDLTNLEHLDLRGNRFNGSIPTQDYNSLRRFRKLEILDLSDNLFNSRIFPFLNSATSLKSLSLWGNNMGGPFPAKELRDLTNVELLDLSRNRFNGSIPVRALFALRKLKALDLSDNEFSSSVELQGKFAKTKPLSGTCPWKNMEELKLSNNKLAGQFPLCLTSLTGLRVLDLSSNQLTGNVPSALANLESLEYLSLFGNNFEGFFSLGLLANLSKLKVLRLDSQSNSLEVEFETSWKPKFQLVVIALRSCNLEKVPHFLLHQKDLHHVDLSDNQIHGNFPSWLLENNTKLEVLLLQNNSFTSFQLPKSAHNLLFLNVSVNKFNHLFLQNFGWILPHLVCVNLAYNGFQGNLPSSLDNMKSIEFLDLSHNRFHGKLPRRFLKGCYNLTILKLSHNKLSGEVFPEAANFTRLWVMSMDNNLFTGNIGKGFRSLPSLNVLDISNNKLTGVIPSWIGERQGLFALQLSNNMLEGEIPTSLFNISYLQLLDLSSNRLSGDIPPHVSSIYHGAVLLLQNNNLSGVIPDTLLLNVIVLDLRNNRLSGNLPEFINTQNISILLLRGNNFTGQIPHQFCSLSNIQLLDLSNNKFNGSIPSCLSNTSFGLRKGDDSYRYDVPSRFGTAKDPVYFESLLMIDEFNMVNETNSQTKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVELGGLVELEALNLSHNNLSGVILESFSGLKNVESLDLSFNRLQGPIPLQLTDMISLAVFNVSYNNLSGIVPQGRQFNTFETQSYFGNPLLCGKSIDISCASNNFHPTDNGVEADESTVDMESFYWSFVAAYVTILLGILASLSFDSPWSRAW

HMMPanther: PTHR24420
1-1017 PTHR24420,FAMILY NOT NAMED

MEGKLFLGQYLICVILLLGQLHGYKSCIEKERKALLELKAFLIPLNAGEWNDNVLSWTNDTKSDCCQWMGVECNRKSGRITNIAFGIGFIIENPLLNLSLLHPFEDVRSLDLSSSRSCEDCGFSGLFDDVEGYKSLSRLRNLEILDLSSHRFNNSIFPFLNAATSLTTLFLTYNNMHSPFLVKEFKDLTNLEHLDLRGNRFNGSIPTQDYNSLRRFRKLEILDLSDNLFNSRIFPFLNSATSLKSLSLWGNNMGGPFPAKELRDLTNVELLDLSRNRFNGSIPVRALFALRKLKALDLSDNEFSSSVELQGKFAKTKPLSGTCPWKNMEELKLSNNKLAGQFPLCLTSLTGLRVLDLSSNQLTGNVPSALANLESLEYLSLFGNNFEGFFSLGLLANLSKLKVLRLDSQSNSLEVEFETSWKPKFQLVVIALRSCNLEKVPHFLLHQKDLHHVDLSDNQIHGNFPSWLLENNTKLEVLLLQNNSFTSFQLPKSAHNLLFLNVSVNKFNHLFLQNFGWILPHLVCVNLAYNGFQGNLPSSLDNMKSIEFLDLSHNRFHGKLPRRFLKGCYNLTILKLSHNKLSGEVFPEAANFTRLWVMSMDNNLFTGNIGKGFRSLPSLNVLDISNNKLTGVIPSWIGERQGLFALQLSNNMLEGEIPTSLFNISYLQLLDLSSNRLSGDIPPHVSSIYHGAVLLLQNNNLSGVIPDTLLLNVIVLDLRNNRLSGNLPEFINTQNISILLLRGNNFTGQIPHQFCSLSNIQLLDLSNNKFNGSIPSCLSNTSFGLRKGDDSYRYDVPSRFGTAKDPVYFESLLMIDEFNMVNETNSQTKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVELGGLVELEALNLSHNNLSGVILESFSGLKNVESLDLSFNRLQGPIPLQLTDMISLAVFNVSYNNLSGIVPQGRQFNTFETQSYFGNPLLCGKSIDISCASNNFHPTDNGVEADESTVDMESFYWSFVAAYVTILLGILASLSFDSPWSRAW

HMMPfam: PF08263
IPR013210
30-74 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

KERKALLELKAFLIPLNAGEWNDNVLSWTNDTKSDCCQWMGVECN

HMMPfam: PF08263
IPR013210
30-74 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

KERKALLELKAFLIPLNAGEWNDNVLSWTNDTKSDCCQWMGVECN

Gene3D: G3DSA:3.80.10.10
31-307 G3DSA:3.80.10.10

ERKALLELKAFLIPLNAGEWNDNVLSWTNDTKSDCCQWMGVECNRKSGRITNIAFGIGFIIENPLLNLSLLHPFEDVRSLDLSSSRSCEDCGFSGLFDDVEGYKSLSRLRNLEILDLSSHRFNNSIFPFLNAATSLTTLFLTYNNMHSPFLVKEFKDLTNLEHLDLRGNRFNGSIPTQDYNSLRRFRKLEILDLSDNLFNSRIFPFLNSATSLKSLSLWGNNMGGPFPAKELRDLTNVELLDLSRNRFNGSIPVRALFALRKLKALDLSDNEFSSSV

Gene3D: G3DSA:3.80.10.10
31-307 G3DSA:3.80.10.10

ERKALLELKAFLIPLNAGEWNDNVLSWTNDTKSDCCQWMGVECNRKSGRITNIAFGIGFIIENPLLNLSLLHPFEDVRSLDLSSSRSCEDCGFSGLFDDVEGYKSLSRLRNLEILDLSSHRFNNSIFPFLNAATSLTTLFLTYNNMHSPFLVKEFKDLTNLEHLDLRGNRFNGSIPTQDYNSLRRFRKLEILDLSDNLFNSRIFPFLNSATSLKSLSLWGNNMGGPFPAKELRDLTNVELLDLSRNRFNGSIPVRALFALRKLKALDLSDNEFSSSV

superfamily: SSF52047
103-412 SSF52047,LRR

PFEDVRSLDLSSSRSCEDCGFSGLFDDVEGYKSLSRLRNLEILDLSSHRFNNSIFPFLNAATSLTTLFLTYNNMHSPFLVKEFKDLTNLEHLDLRGNRFNGSIPTQDYNSLRRFRKLEILDLSDNLFNSRIFPFLNSATSLKSLSLWGNNMGGPFPAKELRDLTNVELLDLSRNRFNGSIPVRALFALRKLKALDLSDNEFSSSVELQGKFAKTKPLSGTCPWKNMEELKLSNNKLAGQFPLCLTSLTGLRVLDLSSNQLTGNVPSALANLESLEYLSLFGNNFEGFFSLGLLANLSKLKVLRLDSQSNS

superfamily: SSF52047
103-412 SSF52047,LRR

PFEDVRSLDLSSSRSCEDCGFSGLFDDVEGYKSLSRLRNLEILDLSSHRFNNSIFPFLNAATSLTTLFLTYNNMHSPFLVKEFKDLTNLEHLDLRGNRFNGSIPTQDYNSLRRFRKLEILDLSDNLFNSRIFPFLNSATSLKSLSLWGNNMGGPFPAKELRDLTNVELLDLSRNRFNGSIPVRALFALRKLKALDLSDNEFSSSVELQGKFAKTKPLSGTCPWKNMEELKLSNNKLAGQFPLCLTSLTGLRVLDLSSNQLTGNVPSALANLESLEYLSLFGNNFEGFFSLGLLANLSKLKVLRLDSQSNS

HMMPfam: PF00560
IPR001611
190-207 LRR_1
Leucine-rich repeat

NLEHLDLRGNRFNGSIPT

HMMPfam: PF00560
IPR001611
190-207 LRR_1
Leucine-rich repeat

NLEHLDLRGNRFNGSIPT

Gene3D: G3DSA:3.80.10.10
323-407 G3DSA:3.80.10.10

CPWKNMEELKLSNNKLAGQFPLCLTSLTGLRVLDLSSNQLTGNVPSALANLESLEYLSLFGNNFEGFFSLGLLANLSKLKVLRLD

Gene3D: G3DSA:3.80.10.10
323-407 G3DSA:3.80.10.10

CPWKNMEELKLSNNKLAGQFPLCLTSLTGLRVLDLSSNQLTGNVPSALANLESLEYLSLFGNNFEGFFSLGLLANLSKLKVLRLD

HMMPfam: PF13855
327-386 LRR_8,Leucine rich repeat

NMEELKLSNNKLAGQFPLCLTSLTGLRVLDLSSNQLTGNVPSALANLESLEYLSLFGNNF

HMMPfam: PF13855
327-386 LRR_8,Leucine rich repeat

NMEELKLSNNKLAGQFPLCLTSLTGLRVLDLSSNQLTGNVPSALANLESLEYLSLFGNNF

FPrintScan: PR00019
352-365 LEURICHRPT,Leucine-rich repeat signature

LRVLDLSSNQLTGN

FPrintScan: PR00019
352-365 LEURICHRPT,Leucine-rich repeat signature

LRVLDLSSNQLTGN

Gene3D: G3DSA:3.80.10.10
408-641 G3DSA:3.80.10.10

SQSNSLEVEFETSWKPKFQLVVIALRSCNLEKVPHFLLHQKDLHHVDLSDNQIHGNFPSWLLENNTKLEVLLLQNNSFTSFQLPKSAHNLLFLNVSVNKFNHLFLQNFGWILPHLVCVNLAYNGFQGNLPSSLDNMKSIEFLDLSHNRFHGKLPRRFLKGCYNLTILKLSHNKLSGEVFPEAANFTRLWVMSMDNNLFTGNIGKGFRSLPSLNVLDISNNKLTGVIPSWIGERQ

Gene3D: G3DSA:3.80.10.10
408-641 G3DSA:3.80.10.10

SQSNSLEVEFETSWKPKFQLVVIALRSCNLEKVPHFLLHQKDLHHVDLSDNQIHGNFPSWLLENNTKLEVLLLQNNSFTSFQLPKSAHNLLFLNVSVNKFNHLFLQNFGWILPHLVCVNLAYNGFQGNLPSSLDNMKSIEFLDLSHNRFHGKLPRRFLKGCYNLTILKLSHNKLSGEVFPEAANFTRLWVMSMDNNLFTGNIGKGFRSLPSLNVLDISNNKLTGVIPSWIGERQ

superfamily: SSF52058
409-557 SSF52058,LRR

QSNSLEVEFETSWKPKFQLVVIALRSCNLEKVPHFLLHQKDLHHVDLSDNQIHGNFPSWLLENNTKLEVLLLQNNSFTSFQLPKSAHNLLFLNVSVNKFNHLFLQNFGWILPHLVCVNLAYNGFQGNLPSSLDNMKSIEFLDLSHNRFH

superfamily: SSF52058
409-557 SSF52058,LRR

QSNSLEVEFETSWKPKFQLVVIALRSCNLEKVPHFLLHQKDLHHVDLSDNQIHGNFPSWLLENNTKLEVLLLQNNSFTSFQLPKSAHNLLFLNVSVNKFNHLFLQNFGWILPHLVCVNLAYNGFQGNLPSSLDNMKSIEFLDLSHNRFH

superfamily: SSF52047
535-980 SSF52047,LRR

NLPSSLDNMKSIEFLDLSHNRFHGKLPRRFLKGCYNLTILKLSHNKLSGEVFPEAANFTRLWVMSMDNNLFTGNIGKGFRSLPSLNVLDISNNKLTGVIPSWIGERQGLFALQLSNNMLEGEIPTSLFNISYLQLLDLSSNRLSGDIPPHVSSIYHGAVLLLQNNNLSGVIPDTLLLNVIVLDLRNNRLSGNLPEFINTQNISILLLRGNNFTGQIPHQFCSLSNIQLLDLSNNKFNGSIPSCLSNTSFGLRKGDDSYRYDVPSRFGTAKDPVYFESLLMIDEFNMVNETNSQTKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVELGGLVELEALNLSHNNLSGVILESFSGLKNVESLDLSFNRLQGPIPLQLTDMISLAVFNVSYNNLSGIVPQGRQFNTFETQSYFGNPLLCGKSIDISCASNNFHPTDNGVEADE

superfamily: SSF52047
535-980 SSF52047,LRR

NLPSSLDNMKSIEFLDLSHNRFHGKLPRRFLKGCYNLTILKLSHNKLSGEVFPEAANFTRLWVMSMDNNLFTGNIGKGFRSLPSLNVLDISNNKLTGVIPSWIGERQGLFALQLSNNMLEGEIPTSLFNISYLQLLDLSSNRLSGDIPPHVSSIYHGAVLLLQNNNLSGVIPDTLLLNVIVLDLRNNRLSGNLPEFINTQNISILLLRGNNFTGQIPHQFCSLSNIQLLDLSNNKFNGSIPSCLSNTSFGLRKGDDSYRYDVPSRFGTAKDPVYFESLLMIDEFNMVNETNSQTKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVELGGLVELEALNLSHNNLSGVILESFSGLKNVESLDLSFNRLQGPIPLQLTDMISLAVFNVSYNNLSGIVPQGRQFNTFETQSYFGNPLLCGKSIDISCASNNFHPTDNGVEADE

HMMPfam: PF13855
545-603 LRR_8,Leucine rich repeat

SIEFLDLSHNRFHGKLPRRFLKGCYNLTILKLSHNKLSGEVFPEAANFTRLWVMSMDNN

HMMPfam: PF13855
545-603 LRR_8,Leucine rich repeat

SIEFLDLSHNRFHGKLPRRFLKGCYNLTILKLSHNKLSGEVFPEAANFTRLWVMSMDNN

FPrintScan: PR00019
616-629 LEURICHRPT,Leucine-rich repeat signature

LPSLNVLDISNNKL

FPrintScan: PR00019
616-629 LEURICHRPT,Leucine-rich repeat signature

LPSLNVLDISNNKL

HMMPfam: PF00560
IPR001611
618-636 LRR_1
Leucine-rich repeat

SLNVLDISNNKLTGVIPSW

HMMPfam: PF00560
IPR001611
618-636 LRR_1
Leucine-rich repeat

SLNVLDISNNKLTGVIPSW

Gene3D: G3DSA:3.80.10.10
645-787 G3DSA:3.80.10.10

ALQLSNNMLEGEIPTSLFNISYLQLLDLSSNRLSGDIPPHVSSIYHGAVLLLQNNNLSGVIPDTLLLNVIVLDLRNNRLSGNLPEFINTQNISILLLRGNNFTGQIPHQFCSLSNIQLLDLSNNKFNGSIPSCLSNTSFGLRK

Gene3D: G3DSA:3.80.10.10
645-787 G3DSA:3.80.10.10

ALQLSNNMLEGEIPTSLFNISYLQLLDLSSNRLSGDIPPHVSSIYHGAVLLLQNNNLSGVIPDTLLLNVIVLDLRNNRLSGNLPEFINTQNISILLLRGNNFTGQIPHQFCSLSNIQLLDLSNNKFNGSIPSCLSNTSFGLRK

HMMPfam: PF00560
IPR001611
667-684 LRR_1
Leucine-rich repeat

LQLLDLSSNRLSGDIPPH

HMMPfam: PF00560
IPR001611
667-684 LRR_1
Leucine-rich repeat

LQLLDLSSNRLSGDIPPH

HMMPfam: PF00560
IPR001611
712-730 LRR_1
Leucine-rich repeat

NVIVLDLRNNRLSGNLPEF

HMMPfam: PF00560
IPR001611
712-730 LRR_1
Leucine-rich repeat

NVIVLDLRNNRLSGNLPEF

Gene3D: G3DSA:3.80.10.10
852-957 G3DSA:3.80.10.10

MDLSENELSGEIPVELGGLVELEALNLSHNNLSGVILESFSGLKNVESLDLSFNRLQGPIPLQLTDMISLAVFNVSYNNLSGIVPQGRQFNTFETQSYFGNPLLCG

Gene3D: G3DSA:3.80.10.10
852-957 G3DSA:3.80.10.10

MDLSENELSGEIPVELGGLVELEALNLSHNNLSGVILESFSGLKNVESLDLSFNRLQGPIPLQLTDMISLAVFNVSYNNLSGIVPQGRQFNTFETQSYFGNPLLCG

HMMPfam: PF13855
853-907 LRR_8,Leucine rich repeat

DLSENELSGEIPVELGGLVELEALNLSHNNLSGVILESFSGLKNVESLDLSFNRL

HMMPfam: PF13855
853-907 LRR_8,Leucine rich repeat

DLSENELSGEIPVELGGLVELEALNLSHNNLSGVILESFSGLKNVESLDLSFNRL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox