PRGDB00062166 (disease resistance protein, putative; 6346-10057)

From PRG Wiki
Jump to: navigation, search
disease resistance protein, putative; 6346-10057
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 9989658 (AC079678)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 1 BAC F9E11 genomic sequence, complete sequence.

DNA Sequence

ATGGAAAGGAAGGTGTTCTCGGGTCAAAACCTGATATGGGTTATGCTACTGTTGGTACAACTACGTGGATACAAATGCTGTATTGAAAAAGAAAGGAAAGCTTTGTTGGAGCTCAAGAAATACATGATCTCAAAAACTGCAGATTGGGGCCTTGACTCTGTTCTCCCTACTTGGACTAATGATACAAAGAGCAATTGTTGTCGCTGGGAGGGCCTTAAGTGCAATCAAACAAGTGGGCGGATTATCGAGCTTTCCATTGGTCAGACGAACTTTAAAGAGAGTTCTCTTTTAAATCTTTCTTTGCTGCATCCGTTTGAAGAGCTTCGAAGTTTGAACTTATCCGGGGAAATATACAACGAATTCAATGGCTTGTTTGATGATGTTGAAGGTTATGAAAGCTTAAGGAGATTAAGAAACCTGGAGATTTTGGATCTCTCTTCAAATAGTTTCAACAACAGCATCTTTCCCTTTCTTAATGCTGCTACATCACTTACAACTCTTTTTATTCAGAGTAACTACATCGGTGGCCCCTTACCTATTAAAGAACTTAAAAACCTTACAAAGTTGGAGCTGCTGGACCTCAGTAGAAGTGGATATAACGGCTCCATCCCAGAACTAAAGGTTTTGACGAACTTGGAAGTCCTGGGTCTTGCTTGGAATCATCTCGACGGACCAATACCAAAAGAAGTTTTTTGTGAAATGAAGAATTTGCGTCAGCTTGATCTCCGTGGAAATTATTTCGAAGGTCAGCTTCCTGTGTGTTTAGGTAACTTGAACAAGCTGCGGGTTCTTGATCTCTCATCAAACCAGTTAAGTGGAAATCTACCAGCTAGTTTCAATAGCCTCGAGTCCCTCGAATATCTATCATTGTCAGATAATAACTTTGAAGGCTTCTTCTCACTCAATCCACTCGCCAACCTCACAAAGCTCAAGGTGTTCAGACTTTCGTCAACATCTGAGATGTTACAAGTAGAGACAGAGAGCAATTGGCTGCCAAAATTTCAACTGACAGTTGCTGCACTACCCTTTTGCAGCTTGGGGAAAATCCCTAATTTTCTCGTCTACCAAACAAATTTGCGTCTAGTTGATCTATCCAGCAATAGATTATCCGGAGACATTCCTACCTGGCTGTTGGAGAATAATCCAGAGCTTAAAGTCTTACAGTTGAAGAATAATTCCTTCACTATCTTTCAGATTCCTACAATAGTGCATAAGTTGCAGGTCTTGGATTTTTCAGCAAATGATATCACCGGAGTGCTCCCTGATAATATTGGCCATGTGCTTCCAAGGCTGCTACATATGAATGGATCTCATAATGGGTTTCAAGGGAATCTTCCATCGTCCATGGGTGAGATGAATGACATTTCATTCCTGGACTTGTCTTACAATAATTTCTCTGGGGAGCTACCTAGAAGCTTATTAACAGGTTGTTTTTCATTAATAACCCTGCAGCTCTCTCACAACAGTTTTAGTGGCCCTATTCTTCCAATACAAACGAGACTAACTTCATTGATCGTATTGAGGATGCATAACAACCTATTTACCGGAGAGATCGGAGTCGGTTTGCGTACCTTGGTTAATTTGTCAATATTTGATGCGTCGAACAATCGTCTCACAGGTCTTATCTCAAGTTCGATACCCCCCGACTCGTCTCATCTGATTATGTTATTGCTATCAAACAATCTCTTAGAAGGTACGTTGCCACCTTCTCTGCTAGCCATTCATCATCTTAATTTTCTGGACCTCTCTGGAAACCTATTATCTGGAGACCTACCGTCGTCAGTTGTTAATTCTATGTACGGGATAAAGATATTCCTTCATAACAACAGCTTCACGGGGCCACTTCCTGTCACGTTGTTGGAAAATGCTTACATACTTGATTTGCGGAATAATAAACTCTCTGGGAGTATCCCACAGTTTGTCAACACCGGGAAAATGATAACTTTATTGTTGAGGGGGAACAATTTAACAGGATCTATACCAAGGAAGCTGTGTGATTTGACCAGCATCAGACTTTTAGATCTTTCAGACAACAAGCTCAATGGCGTCATACCTCCATGCCTCAATCATTTATCAACTGAATTGGGAGAAGGGATTGGGTTGAGTGGCTTCTCTCAGGAGATTAGCTTTGGAGACAGCCTTCAGATGGAATTTTACAGATCCACATTTTTGGTAGATGAGTTCATGCTATACTATGATTCTACATATATGATTGTTGAAATCGAATTTGCAGCAAAGCAAAGGTATGACTCTTTCAGTGGAGGAACACTTGACTATATGTATGGGTTGGATCTATCAAGCAATGAATTAAGTGGTGTTATCCCAGCAGAGCTTGGAGATCTCTCGAAACTACGAGCCCTGAATCTATCTCGCAATTTATTGTCGAGTTCTATACCAGCTAACTTCTCCAAACTGAAGGACATTGAGAGCCTTGATCTTTCTTATAACATGTTACAGGGAAACATTCCTCACCAACTAACCAACCTCACTTCTCTTGCTGTTTTCAACGTCTCTTTCAACAATTTATCAGGAATCATTCCTCAAGGAGGACAGTTTAACACCTTCAACGATAACAGCTACTTAGGAAATCCTCTTCTTTGTGGGACACCGACCGATAGAAGTTGTGAAGGTAAGAAGAACACAAAGGAAGCAGATAACGGAGGAGAAGAAGAAGAAGAAGATGATGATGATGAAGCTGCTATTGACATGGTGGTCTTGTATTGGACTACTGGTTCAACTTATGCGATTGCGTTGATCGGCATTCTTGTACTTATGTGCTTCGATTGTCCTTGGCGTCGGACATGGCTCTGCATTGTCGACGCTTTCATAGCCTCTGGGAAAAGTATGTTTTCTTGA


Protein sequences

Name Description Sequence
disease resistance protein, putative; 6346-10057 disease resistance protein, putative; 6346-10057 [Arabidopsis thaliana].

MERKVFSGQNLIWVMLLLVQLRGYKCCIEKERKALLELKKYMISKTADWGLDSVLPTWTNDTKSNCCRWEGLKCNQTSGRIIELSIGQTNFKESSLLNLSLLHPFEELRSLNLSGEIYNEFNGLFDDVEGYESLRRLRNLEILDLSSNSFNNSIFPFLNAATSLTTLFIQSNYIGGPLPIKELKNLTKLELLDLSRSGYNGSIPELKVLTNLEVLGLAWNHLDGPIPKEVFCEMKNLRQLDLRGNYFEGQLPVCLGNLNKLRVLDLSSNQLSGNLPASFNSLESLEYLSLSDNNFEGFFSLNPLANLTKLKVFRLSSTSEMLQVETESNWLPKFQLTVAALPFCSLGKIPNFLVYQTNLRLVDLSSNRLSGDIPTWLLENNPELKVLQLKNNSFTIFQIPTIVHKLQVLDFSANDITGVLPDNIGHVLPRLLHMNGSHNGFQGNLPSSMGEMNDISFLDLSYNNFSGELPRSLLTGCFSLITLQLSHNSFSGPILPIQTRLTSLIVLRMHNNLFTGEIGVGLRTLVNLSIFDASNNRLTGLISSSIPPDSSHLIMLLLSNNLLEGTLPPSLLAIHHLNFLDLSGNLLSGDLPSSVVNSMYGIKIFLHNNSFTGPLPVTLLENAYILDLRNNKLSGSIPQFVNTGKMITLLLRGNNLTGSIPRKLCDLTSIRLLDLSDNKLNGVIPPCLNHLSTELGEGIGLSGFSQEISFGDSLQMEFYRSTFLVDEFMLYYDSTYMIVEIEFAAKQRYDSFSGGTLDYMYGLDLSSNELSGVIPAELGDLSKLRALNLSRNLLSSSIPANFSKLKDIESLDLSYNMLQGNIPHQLTNLTSLAVFNVSFNNLSGIIPQGGQFNTFNDNSYLGNPLLCGTPTDRSCEGKKNTKEADNGGEEEEEDDDDEAAIDMVVLYWTTGSTYAIALIGILVLMCFDCPWRRTWLCIVDAFIASGKSMFS

disease resistance protein, putative; 6346-10057 disease resistance protein, putative; 6346-10057 [Arabidopsis thaliana].

MERKVFSGQNLIWVMLLLVQLRGYKCCIEKERKALLELKKYMISKTADWGLDSVLPTWTNDTKSNCCRWEGLKCNQTSGRIIELSIGQTNFKESSLLNLSLLHPFEELRSLNLSGEIYNEFNGLFDDVEGYESLRRLRNLEILDLSSNSFNNSIFPFLNAATSLTTLFIQSNYIGGPLPIKELKNLTKLELLDLSRSGYNGSIPELKVLTNLEVLGLAWNHLDGPIPKEVFCEMKNLRQLDLRGNYFEGQLPVCLGNLNKLRVLDLSSNQLSGNLPASFNSLESLEYLSLSDNNFEGFFSLNPLANLTKLKVFRLSSTSEMLQVETESNWLPKFQLTVAALPFCSLGKIPNFLVYQTNLRLVDLSSNRLSGDIPTWLLENNPELKVLQLKNNSFTIFQIPTIVHKLQVLDFSANDITGVLPDNIGHVLPRLLHMNGSHNGFQGNLPSSMGEMNDISFLDLSYNNFSGELPRSLLTGCFSLITLQLSHNSFSGPILPIQTRLTSLIVLRMHNNLFTGEIGVGLRTLVNLSIFDASNNRLTGLISSSIPPDSSHLIMLLLSNNLLEGTLPPSLLAIHHLNFLDLSGNLLSGDLPSSVVNSMYGIKIFLHNNSFTGPLPVTLLENAYILDLRNNKLSGSIPQFVNTGKMITLLLRGNNLTGSIPRKLCDLTSIRLLDLSDNKLNGVIPPCLNHLSTELGEGIGLSGFSQEISFGDSLQMEFYRSTFLVDEFMLYYDSTYMIVEIEFAAKQRYDSFSGGTLDYMYGLDLSSNELSGVIPAELGDLSKLRALNLSRNLLSSSIPANFSKLKDIESLDLSYNMLQGNIPHQLTNLTSLAVFNVSFNNLSGIIPQGGQFNTFNDNSYLGNPLLCGTPTDRSCEGKKNTKEADNGGEEEEEDDDDEAAIDMVVLYWTTGSTYAIALIGILVLMCFDCPWRRTWLCIVDAFIASGKSMFS


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
10-935 PTHR24420,FAMILY NOT NAMED

NLIWVMLLLVQLRGYKCCIEKERKALLELKKYMISKTADWGLDSVLPTWTNDTKSNCCRWEGLKCNQTSGRIIELSIGQTNFKESSLLNLSLLHPFEELRSLNLSGEIYNEFNGLFDDVEGYESLRRLRNLEILDLSSNSFNNSIFPFLNAATSLTTLFIQSNYIGGPLPIKELKNLTKLELLDLSRSGYNGSIPELKVLTNLEVLGLAWNHLDGPIPKEVFCEMKNLRQLDLRGNYFEGQLPVCLGNLNKLRVLDLSSNQLSGNLPASFNSLESLEYLSLSDNNFEGFFSLNPLANLTKLKVFRLSSTSEMLQVETESNWLPKFQLTVAALPFCSLGKIPNFLVYQTNLRLVDLSSNRLSGDIPTWLLENNPELKVLQLKNNSFTIFQIPTIVHKLQVLDFSANDITGVLPDNIGHVLPRLLHMNGSHNGFQGNLPSSMGEMNDISFLDLSYNNFSGELPRSLLTGCFSLITLQLSHNSFSGPILPIQTRLTSLIVLRMHNNLFTGEIGVGLRTLVNLSIFDASNNRLTGLISSSIPPDSSHLIMLLLSNNLLEGTLPPSLLAIHHLNFLDLSGNLLSGDLPSSVVNSMYGIKIFLHNNSFTGPLPVTLLENAYILDLRNNKLSGSIPQFVNTGKMITLLLRGNNLTGSIPRKLCDLTSIRLLDLSDNKLNGVIPPCLNHLSTELGEGIGLSGFSQEISFGDSLQMEFYRSTFLVDEFMLYYDSTYMIVEIEFAAKQRYDSFSGGTLDYMYGLDLSSNELSGVIPAELGDLSKLRALNLSRNLLSSSIPANFSKLKDIESLDLSYNMLQGNIPHQLTNLTSLAVFNVSFNNLSGIIPQGGQFNTFNDNSYLGNPLLCGTPTDRSCEGKKNTKEADNGGEEEEEDDDDEAAIDMVVLYWTTGSTYAIALIGILVLMCFDCPWRRTW

HMMPanther: PTHR24420:SF914
10-935 PTHR24420:SF914

NLIWVMLLLVQLRGYKCCIEKERKALLELKKYMISKTADWGLDSVLPTWTNDTKSNCCRWEGLKCNQTSGRIIELSIGQTNFKESSLLNLSLLHPFEELRSLNLSGEIYNEFNGLFDDVEGYESLRRLRNLEILDLSSNSFNNSIFPFLNAATSLTTLFIQSNYIGGPLPIKELKNLTKLELLDLSRSGYNGSIPELKVLTNLEVLGLAWNHLDGPIPKEVFCEMKNLRQLDLRGNYFEGQLPVCLGNLNKLRVLDLSSNQLSGNLPASFNSLESLEYLSLSDNNFEGFFSLNPLANLTKLKVFRLSSTSEMLQVETESNWLPKFQLTVAALPFCSLGKIPNFLVYQTNLRLVDLSSNRLSGDIPTWLLENNPELKVLQLKNNSFTIFQIPTIVHKLQVLDFSANDITGVLPDNIGHVLPRLLHMNGSHNGFQGNLPSSMGEMNDISFLDLSYNNFSGELPRSLLTGCFSLITLQLSHNSFSGPILPIQTRLTSLIVLRMHNNLFTGEIGVGLRTLVNLSIFDASNNRLTGLISSSIPPDSSHLIMLLLSNNLLEGTLPPSLLAIHHLNFLDLSGNLLSGDLPSSVVNSMYGIKIFLHNNSFTGPLPVTLLENAYILDLRNNKLSGSIPQFVNTGKMITLLLRGNNLTGSIPRKLCDLTSIRLLDLSDNKLNGVIPPCLNHLSTELGEGIGLSGFSQEISFGDSLQMEFYRSTFLVDEFMLYYDSTYMIVEIEFAAKQRYDSFSGGTLDYMYGLDLSSNELSGVIPAELGDLSKLRALNLSRNLLSSSIPANFSKLKDIESLDLSYNMLQGNIPHQLTNLTSLAVFNVSFNNLSGIIPQGGQFNTFNDNSYLGNPLLCGTPTDRSCEGKKNTKEADNGGEEEEEDDDDEAAIDMVVLYWTTGSTYAIALIGILVLMCFDCPWRRTW

HMMPanther: PTHR24420
10-935 PTHR24420,FAMILY NOT NAMED

NLIWVMLLLVQLRGYKCCIEKERKALLELKKYMISKTADWGLDSVLPTWTNDTKSNCCRWEGLKCNQTSGRIIELSIGQTNFKESSLLNLSLLHPFEELRSLNLSGEIYNEFNGLFDDVEGYESLRRLRNLEILDLSSNSFNNSIFPFLNAATSLTTLFIQSNYIGGPLPIKELKNLTKLELLDLSRSGYNGSIPELKVLTNLEVLGLAWNHLDGPIPKEVFCEMKNLRQLDLRGNYFEGQLPVCLGNLNKLRVLDLSSNQLSGNLPASFNSLESLEYLSLSDNNFEGFFSLNPLANLTKLKVFRLSSTSEMLQVETESNWLPKFQLTVAALPFCSLGKIPNFLVYQTNLRLVDLSSNRLSGDIPTWLLENNPELKVLQLKNNSFTIFQIPTIVHKLQVLDFSANDITGVLPDNIGHVLPRLLHMNGSHNGFQGNLPSSMGEMNDISFLDLSYNNFSGELPRSLLTGCFSLITLQLSHNSFSGPILPIQTRLTSLIVLRMHNNLFTGEIGVGLRTLVNLSIFDASNNRLTGLISSSIPPDSSHLIMLLLSNNLLEGTLPPSLLAIHHLNFLDLSGNLLSGDLPSSVVNSMYGIKIFLHNNSFTGPLPVTLLENAYILDLRNNKLSGSIPQFVNTGKMITLLLRGNNLTGSIPRKLCDLTSIRLLDLSDNKLNGVIPPCLNHLSTELGEGIGLSGFSQEISFGDSLQMEFYRSTFLVDEFMLYYDSTYMIVEIEFAAKQRYDSFSGGTLDYMYGLDLSSNELSGVIPAELGDLSKLRALNLSRNLLSSSIPANFSKLKDIESLDLSYNMLQGNIPHQLTNLTSLAVFNVSFNNLSGIIPQGGQFNTFNDNSYLGNPLLCGTPTDRSCEGKKNTKEADNGGEEEEEDDDDEAAIDMVVLYWTTGSTYAIALIGILVLMCFDCPWRRTW

HMMPanther: PTHR24420:SF914
10-935 PTHR24420:SF914

NLIWVMLLLVQLRGYKCCIEKERKALLELKKYMISKTADWGLDSVLPTWTNDTKSNCCRWEGLKCNQTSGRIIELSIGQTNFKESSLLNLSLLHPFEELRSLNLSGEIYNEFNGLFDDVEGYESLRRLRNLEILDLSSNSFNNSIFPFLNAATSLTTLFIQSNYIGGPLPIKELKNLTKLELLDLSRSGYNGSIPELKVLTNLEVLGLAWNHLDGPIPKEVFCEMKNLRQLDLRGNYFEGQLPVCLGNLNKLRVLDLSSNQLSGNLPASFNSLESLEYLSLSDNNFEGFFSLNPLANLTKLKVFRLSSTSEMLQVETESNWLPKFQLTVAALPFCSLGKIPNFLVYQTNLRLVDLSSNRLSGDIPTWLLENNPELKVLQLKNNSFTIFQIPTIVHKLQVLDFSANDITGVLPDNIGHVLPRLLHMNGSHNGFQGNLPSSMGEMNDISFLDLSYNNFSGELPRSLLTGCFSLITLQLSHNSFSGPILPIQTRLTSLIVLRMHNNLFTGEIGVGLRTLVNLSIFDASNNRLTGLISSSIPPDSSHLIMLLLSNNLLEGTLPPSLLAIHHLNFLDLSGNLLSGDLPSSVVNSMYGIKIFLHNNSFTGPLPVTLLENAYILDLRNNKLSGSIPQFVNTGKMITLLLRGNNLTGSIPRKLCDLTSIRLLDLSDNKLNGVIPPCLNHLSTELGEGIGLSGFSQEISFGDSLQMEFYRSTFLVDEFMLYYDSTYMIVEIEFAAKQRYDSFSGGTLDYMYGLDLSSNELSGVIPAELGDLSKLRALNLSRNLLSSSIPANFSKLKDIESLDLSYNMLQGNIPHQLTNLTSLAVFNVSFNNLSGIIPQGGQFNTFNDNSYLGNPLLCGTPTDRSCEGKKNTKEADNGGEEEEEDDDDEAAIDMVVLYWTTGSTYAIALIGILVLMCFDCPWRRTW

HMMPfam: PF08263
IPR013210
30-75 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

KERKALLELKKYMISKTADWGLDSVLPTWTNDTKSNCCRWEGLKCN

HMMPfam: PF08263
IPR013210
30-75 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

KERKALLELKKYMISKTADWGLDSVLPTWTNDTKSNCCRWEGLKCN

Gene3D: G3DSA:3.80.10.10
55-317 G3DSA:3.80.10.10

LPTWTNDTKSNCCRWEGLKCNQTSGRIIELSIGQTNFKESSLLNLSLLHPFEELRSLNLSGEIYNEFNGLFDDVEGYESLRRLRNLEILDLSSNSFNNSIFPFLNAATSLTTLFIQSNYIGGPLPIKELKNLTKLELLDLSRSGYNGSIPELKVLTNLEVLGLAWNHLDGPIPKEVFCEMKNLRQLDLRGNYFEGQLPVCLGNLNKLRVLDLSSNQLSGNLPASFNSLESLEYLSLSDNNFEGFFSLNPLANLTKLKVFRLSS

Gene3D: G3DSA:3.80.10.10
55-317 G3DSA:3.80.10.10

LPTWTNDTKSNCCRWEGLKCNQTSGRIIELSIGQTNFKESSLLNLSLLHPFEELRSLNLSGEIYNEFNGLFDDVEGYESLRRLRNLEILDLSSNSFNNSIFPFLNAATSLTTLFIQSNYIGGPLPIKELKNLTKLELLDLSRSGYNGSIPELKVLTNLEVLGLAWNHLDGPIPKEVFCEMKNLRQLDLRGNYFEGQLPVCLGNLNKLRVLDLSSNQLSGNLPASFNSLESLEYLSLSDNNFEGFFSLNPLANLTKLKVFRLSS

superfamily: SSF52058
65-398 SSF52058,LRR

NCCRWEGLKCNQTSGRIIELSIGQTNFKESSLLNLSLLHPFEELRSLNLSGEIYNEFNGLFDDVEGYESLRRLRNLEILDLSSNSFNNSIFPFLNAATSLTTLFIQSNYIGGPLPIKELKNLTKLELLDLSRSGYNGSIPELKVLTNLEVLGLAWNHLDGPIPKEVFCEMKNLRQLDLRGNYFEGQLPVCLGNLNKLRVLDLSSNQLSGNLPASFNSLESLEYLSLSDNNFEGFFSLNPLANLTKLKVFRLSSTSEMLQVETESNWLPKFQLTVAALPFCSLGKIPNFLVYQTNLRLVDLSSNRLSGDIPTWLLENNPELKVLQLKNNSFTIFQ

superfamily: SSF52058
65-398 SSF52058,LRR

NCCRWEGLKCNQTSGRIIELSIGQTNFKESSLLNLSLLHPFEELRSLNLSGEIYNEFNGLFDDVEGYESLRRLRNLEILDLSSNSFNNSIFPFLNAATSLTTLFIQSNYIGGPLPIKELKNLTKLELLDLSRSGYNGSIPELKVLTNLEVLGLAWNHLDGPIPKEVFCEMKNLRQLDLRGNYFEGQLPVCLGNLNKLRVLDLSSNQLSGNLPASFNSLESLEYLSLSDNNFEGFFSLNPLANLTKLKVFRLSSTSEMLQVETESNWLPKFQLTVAALPFCSLGKIPNFLVYQTNLRLVDLSSNRLSGDIPTWLLENNPELKVLQLKNNSFTIFQ

ProfileScan: PS51450
IPR001611
139-159 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEILDLSSNSFNNSIFPFLN

ProfileScan: PS51450
IPR001611
139-159 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEILDLSSNSFNNSIFPFLN

ProfileScan: PS51450
IPR001611
163-184 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTTLFIQSNYIGGPLPIKELK

ProfileScan: PS51450
IPR001611
163-184 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTTLFIQSNYIGGPLPIKELK

ProfileScan: PS51450
IPR001611
188-210 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLELLDLSRSGYNGSIPELKVLT

ProfileScan: PS51450
IPR001611
188-210 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLELLDLSRSGYNGSIPELKVLT

ProfileScan: PS51450
IPR001611
211-233 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEVLGLAWNHLDGPIPKEVFCE

ProfileScan: PS51450
IPR001611
211-233 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEVLGLAWNHLDGPIPKEVFCE

ProfileScan: PS51450
IPR001611
236-259 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRQLDLRGNYFEGQLPVCLGNLN

ProfileScan: PS51450
IPR001611
236-259 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRQLDLRGNYFEGQLPVCLGNLN

HMMPfam: PF13855
236-295 LRR_8,Leucine rich repeat

NLRQLDLRGNYFEGQLPVCLGNLNKLRVLDLSSNQLSGNLPASFNSLESLEYLSLSDNNF

HMMPfam: PF13855
236-295 LRR_8,Leucine rich repeat

NLRQLDLRGNYFEGQLPVCLGNLNKLRVLDLSSNQLSGNLPASFNSLESLEYLSLSDNNF

ProfileScan: PS51450
IPR001611
260-282 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRVLDLSSNQLSGNLPASFNSL

ProfileScan: PS51450
IPR001611
260-282 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRVLDLSSNQLSGNLPASFNSL

FPrintScan: PR00019
261-274 LEURICHRPT,Leucine-rich repeat signature

LRVLDLSSNQLSGN

FPrintScan: PR00019
261-274 LEURICHRPT,Leucine-rich repeat signature

LRVLDLSSNQLSGN

ProfileScan: PS51450
IPR001611
284-305 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEYLSLSDNNFEGFFSLNPLA

ProfileScan: PS51450
IPR001611
284-305 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEYLSLSDNNFEGFFSLNPLA

Gene3D: G3DSA:3.80.10.10
335-546 G3DSA:3.80.10.10

QLTVAALPFCSLGKIPNFLVYQTNLRLVDLSSNRLSGDIPTWLLENNPELKVLQLKNNSFTIFQIPTIVHKLQVLDFSANDITGVLPDNIGHVLPRLLHMNGSHNGFQGNLPSSMGEMNDISFLDLSYNNFSGELPRSLLTGCFSLITLQLSHNSFSGPILPIQTRLTSLIVLRMHNNLFTGEIGVGLRTLVNLSIFDASNNRLTGLISSSI

superfamily: SSF52058
335-621 SSF52058,LRR

QLTVAALPFCSLGKIPNFLVYQTNLRLVDLSSNRLSGDIPTWLLENNPELKVLQLKNNSFTIFQIPTIVHKLQVLDFSANDITGVLPDNIGHVLPRLLHMNGSHNGFQGNLPSSMGEMNDISFLDLSYNNFSGELPRSLLTGCFSLITLQLSHNSFSGPILPIQTRLTSLIVLRMHNNLFTGEIGVGLRTLVNLSIFDASNNRLTGLISSSIPPDSSHLIMLLLSNNLLEGTLPPSLLAIHHLNFLDLSGNLLSGDLPSSVVNSMYGIKIFLHNNSFTGPLPVTLLE

Gene3D: G3DSA:3.80.10.10
335-546 G3DSA:3.80.10.10

QLTVAALPFCSLGKIPNFLVYQTNLRLVDLSSNRLSGDIPTWLLENNPELKVLQLKNNSFTIFQIPTIVHKLQVLDFSANDITGVLPDNIGHVLPRLLHMNGSHNGFQGNLPSSMGEMNDISFLDLSYNNFSGELPRSLLTGCFSLITLQLSHNSFSGPILPIQTRLTSLIVLRMHNNLFTGEIGVGLRTLVNLSIFDASNNRLTGLISSSI

superfamily: SSF52058
335-621 SSF52058,LRR

QLTVAALPFCSLGKIPNFLVYQTNLRLVDLSSNRLSGDIPTWLLENNPELKVLQLKNNSFTIFQIPTIVHKLQVLDFSANDITGVLPDNIGHVLPRLLHMNGSHNGFQGNLPSSMGEMNDISFLDLSYNNFSGELPRSLLTGCFSLITLQLSHNSFSGPILPIQTRLTSLIVLRMHNNLFTGEIGVGLRTLVNLSIFDASNNRLTGLISSSIPPDSSHLIMLLLSNNLLEGTLPPSLLAIHHLNFLDLSGNLLSGDLPSSVVNSMYGIKIFLHNNSFTGPLPVTLLE

HMMPfam: PF00560
IPR001611
358-380 LRR_1
Leucine-rich repeat

NLRLVDLSSNRLSGDIPTWLLEN

ProfileScan: PS51450
IPR001611
358-380 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRLVDLSSNRLSGDIPTWLLEN

HMMPfam: PF00560
IPR001611
358-380 LRR_1
Leucine-rich repeat

NLRLVDLSSNRLSGDIPTWLLEN

ProfileScan: PS51450
IPR001611
358-380 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRLVDLSSNRLSGDIPTWLLEN

ProfileScan: PS51450
IPR001611
405-427 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQVLDFSANDITGVLPDNIGHV

ProfileScan: PS51450
IPR001611
405-427 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQVLDFSANDITGVLPDNIGHV

ProfileScan: PS51450
IPR001611
454-475 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DISFLDLSYNNFSGELPRSLLT

ProfileScan: PS51450
IPR001611
454-475 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DISFLDLSYNNFSGELPRSLLT

HMMPfam: PF00560
IPR001611
457-476 LRR_1
Leucine-rich repeat

FLDLSYNNFSGELPRSLLTG

HMMPfam: PF00560
IPR001611
457-476 LRR_1
Leucine-rich repeat

FLDLSYNNFSGELPRSLLTG

ProfileScan: PS51450
IPR001611
479-501 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLITLQLSHNSFSGPILPIQTRL

ProfileScan: PS51450
IPR001611
479-501 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLITLQLSHNSFSGPILPIQTRL

ProfileScan: PS51450
IPR001611
527-548 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSIFDASNNRLTGLISSSIPP

ProfileScan: PS51450
IPR001611
527-548 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSIFDASNNRLTGLISSSIPP

Gene3D: G3DSA:3.80.10.10
547-697 G3DSA:3.80.10.10

PPDSSHLIMLLLSNNLLEGTLPPSLLAIHHLNFLDLSGNLLSGDLPSSVVNSMYGIKIFLHNNSFTGPLPVTLLENAYILDLRNNKLSGSIPQFVNTGKMITLLLRGNNLTGSIPRKLCDLTSIRLLDLSDNKLNGVIPPCLNHLSTELGE

Gene3D: G3DSA:3.80.10.10
547-697 G3DSA:3.80.10.10

PPDSSHLIMLLLSNNLLEGTLPPSLLAIHHLNFLDLSGNLLSGDLPSSVVNSMYGIKIFLHNNSFTGPLPVTLLENAYILDLRNNKLSGSIPQFVNTGKMITLLLRGNNLTGSIPRKLCDLTSIRLLDLSDNKLNGVIPPCLNHLSTELGE

ProfileScan: PS51450
IPR001611
552-573 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLIMLLLSNNLLEGTLPPSLLA

ProfileScan: PS51450
IPR001611
552-573 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLIMLLLSNNLLEGTLPPSLLA

HMMPfam: PF00560
IPR001611
576-594 LRR_1
Leucine-rich repeat

HLNFLDLSGNLLSGDLPSS

ProfileScan: PS51450
IPR001611
576-598 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLNFLDLSGNLLSGDLPSSVVNS

HMMPfam: PF00560
IPR001611
576-594 LRR_1
Leucine-rich repeat

HLNFLDLSGNLLSGDLPSS

ProfileScan: PS51450
IPR001611
576-598 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLNFLDLSGNLLSGDLPSSVVNS

ProfileScan: PS51450
IPR001611
622-644 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NAYILDLRNNKLSGSIPQFVNTG

ProfileScan: PS51450
IPR001611
622-644 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NAYILDLRNNKLSGSIPQFVNTG

superfamily: SSF52058
625-875 SSF52058,LRR

ILDLRNNKLSGSIPQFVNTGKMITLLLRGNNLTGSIPRKLCDLTSIRLLDLSDNKLNGVIPPCLNHLSTELGEGIGLSGFSQEISFGDSLQMEFYRSTFLVDEFMLYYDSTYMIVEIEFAAKQRYDSFSGGTLDYMYGLDLSSNELSGVIPAELGDLSKLRALNLSRNLLSSSIPANFSKLKDIESLDLSYNMLQGNIPHQLTNLTSLAVFNVSFNNLSGIIPQGGQFNTFNDNSYLGNPLLCGTPTDRSC

superfamily: SSF52058
625-875 SSF52058,LRR

ILDLRNNKLSGSIPQFVNTGKMITLLLRGNNLTGSIPRKLCDLTSIRLLDLSDNKLNGVIPPCLNHLSTELGEGIGLSGFSQEISFGDSLQMEFYRSTFLVDEFMLYYDSTYMIVEIEFAAKQRYDSFSGGTLDYMYGLDLSSNELSGVIPAELGDLSKLRALNLSRNLLSSSIPANFSKLKDIESLDLSYNMLQGNIPHQLTNLTSLAVFNVSFNNLSGIIPQGGQFNTFNDNSYLGNPLLCGTPTDRSC

FPrintScan: PR00019
667-680 LEURICHRPT,Leucine-rich repeat signature

LTSIRLLDLSDNKL

FPrintScan: PR00019
667-680 LEURICHRPT,Leucine-rich repeat signature

LTSIRLLDLSDNKL

ProfileScan: PS51450
IPR001611
669-692 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SIRLLDLSDNKLNGVIPPCLNHLS

ProfileScan: PS51450
IPR001611
669-692 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SIRLLDLSDNKLNGVIPPCLNHLS

Gene3D: G3DSA:3.80.10.10
763-871 G3DSA:3.80.10.10

LDLSSNELSGVIPAELGDLSKLRALNLSRNLLSSSIPANFSKLKDIESLDLSYNMLQGNIPHQLTNLTSLAVFNVSFNNLSGIIPQGGQFNTFNDNSYLGNPLLCGTPT

Gene3D: G3DSA:3.80.10.10
763-871 G3DSA:3.80.10.10

LDLSSNELSGVIPAELGDLSKLRALNLSRNLLSSSIPANFSKLKDIESLDLSYNMLQGNIPHQLTNLTSLAVFNVSFNNLSGIIPQGGQFNTFNDNSYLGNPLLCGTPT

HMMPfam: PF13855
763-818 LRR_8,Leucine rich repeat

LDLSSNELSGVIPAELGDLSKLRALNLSRNLLSSSIPANFSKLKDIESLDLSYNML

HMMPfam: PF13855
763-818 LRR_8,Leucine rich repeat

LDLSSNELSGVIPAELGDLSKLRALNLSRNLLSSSIPANFSKLKDIESLDLSYNML

ProfileScan: PS51450
IPR001611
783-806 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRALNLSRNLLSSSIPANFSKLK

ProfileScan: PS51450
IPR001611
783-806 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRALNLSRNLLSSSIPANFSKLK

ProfileScan: PS51450
IPR001611
807-830 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DIESLDLSYNMLQGNIPHQLTNLT

ProfileScan: PS51450
IPR001611
807-830 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DIESLDLSYNMLQGNIPHQLTNLT

ProfileScan: PS51450
IPR001611
831-852 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLAVFNVSFNNLSGIIPQGGQF

ProfileScan: PS51450
IPR001611
831-852 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLAVFNVSFNNLSGIIPQGGQF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox