PRGDB00062172 (disease resistance protein MLO, putative; 5304-2185)

From PRG Wiki
Jump to: navigation, search
disease resistance protein MLO, putative; 5304-2185
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 12322414 (AC035249)
Gene Class Mlo-like
Domain Type MLO
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 1 BAC F8D11 genomic sequence, complete sequence.

DNA Sequence

ATGGGATCCACAATGAAGCGATCAGTGTTTGATGAGCAAACTTCAAAAGCATTAGAACAATGGCATAAGAAGGCGAGGAAAAAGAATGAAAAGTGAGGTGGGAGTACAATTCCTATGCAGTTATATCACATTGCCCCTTTACGCTCTCGTCACTCAGTATGAGTTTGGGCTAAGGTCCTGTTTTCATCACCATTTTGGCCTTATAATCATTCGTGTCTGCCTAGGTTAACACTAGCCATAGGAACAAAGCTACAAGCCATTATATCGTACATGGCATTGGAGATTCAAGAGAGACATGCAGTAATTCAAGGGATGCCAGTTGTCAACGTCTCAGACCAACATTTTTGGTTTGAAAAACCCGATCTAGTACTTCATATGATCCACTTCGTTCTGTTTCAGGATGGTATGTTACTGCCGTAATCACCATGATTCCTCCTCTAACCCGAGCTTTGGGCCTTTGTAATGTTGTTTTTACTCTTCGATGTTCACGGTTCATTTGGCACCTGGTATGAAGTTTGATTTTCAAAAGTACATCAAAAGATCTTTGGAAGACGACTTCAAGGTGGTTGTAGGAATAAGATGTGCTTCTTCCGTCAAATACTTAGATCAGTGAGGAAGTCTGATTACTTGACAATGCGACATGGATTCATAAGTATCCATCAAGATTTAGACTCACACATGAGACATCATTTGTCCGAGAACATGTCAATTCTTGGGCTAGCAATAAATTCTTCTTCTACGTTATTCGTGGCTGGAAAGTATGGGAGCAAGAGGTCATCCATGAACAAGAAATGATGAATGGATTATGTCGCACTTATATCATTAAACGCATTACATCAAGTGCATATATTCATATTCTTCTTGGCCGTGTTCCATGTTATATATAGTGCTATAACCATGATGCTTGGAAGAGCCAAGAGCTTATGGTTTTGGGATTTATTTCCCTGCTTCTAACATTTGGCCAAAACTACATTGCGAGCATATGTGTTCCATCAAGATACGGCCATGCAATGTCTTTTTGTGGTCCATATGATGGACCTAGTGAAGATGATCGTAAAAAGCTCAAGAAAACAGACCATGCAATGCGTATTCTCTACTCTGTTCAACGTCGTTCTTTGGCCGACGCTCCTCCAGTTTTCGAACGAAAGAAGAAGAAAGCTTTGTTTGAAGCTCTTGAGAAGATTAAAAATGATGGCTGGAGGTGGTGGTGGAGGAGGTGGCGAAGGTCCAAGACAGCTAGACCAGACCCCGACTTGGGCCGTTTCTACAGTTTGTGGTGTTATCATCTTGATCTCCATTATTTTGGAACTCATCATTCACAAAGTCGGCGAG


Protein sequences

Name Description Sequence
disease resistance protein MLO, putative; 5304-2185 disease resistance protein MLO, putative; 5304-2185 [Arabidopsis thaliana].

MAGGGGGGGGEGPRQLDQTPTWAVSTVCGVIILISIILELIIHKVGEVFERKKKKALFEALEKIKNELMVLGFISLLLTFGQNYIASICVPSRYGHAMSFCGPYDGPSEDDRKKLKKTDHAMRILYSVQRRSLADAPPDYVALISLNALHQVHIFIFFLAVFHVIYSAITMMLGRAKIRGWKVWEQEVIHEQEMMNDPSRFRLTHETSFVREHVNSWASNKFFFYVMCFFRQILRSVRKSDYLTMRHGFISVHLAPGMKFDFQKYIKRSLEDDFKVVVGIRPELWAFVMLFLLFDVHGWYVTAVITMIPPLLTLAIGTKLQAIISYMALEIQERHAVIQGMPVVNVSDQHFWFEKPDLVLHMIHFVLFQYEFGLRSCFHHHFGLIIIRVCLGVGVQFLCSYITLPLYALVTQMGSTMKRSVFDEQTSKALEQWHKKARKKNEK

disease resistance protein MLO, putative; 5304-2185 disease resistance protein MLO, putative; 5304-2185 [Arabidopsis thaliana].

MAGGGGGGGGEGPRQLDQTPTWAVSTVCGVIILISIILELIIHKVGEVFERKKKKALFEALEKIKNELMVLGFISLLLTFGQNYIASICVPSRYGHAMSFCGPYDGPSEDDRKKLKKTDHAMRILYSVQRRSLADAPPDYVALISLNALHQVHIFIFFLAVFHVIYSAITMMLGRAKIRGWKVWEQEVIHEQEMMNDPSRFRLTHETSFVREHVNSWASNKFFFYVMCFFRQILRSVRKSDYLTMRHGFISVHLAPGMKFDFQKYIKRSLEDDFKVVVGIRPELWAFVMLFLLFDVHGWYVTAVITMIPPLLTLAIGTKLQAIISYMALEIQERHAVIQGMPVVNVSDQHFWFEKPDLVLHMIHFVLFQYEFGLRSCFHHHFGLIIIRVCLGVGVQFLCSYITLPLYALVTQMGSTMKRSVFDEQTSKALEQWHKKARKKNEK

Domains

Domain Start-End Description Sequence

Seg: seg
3-12 seg

GGGGGGGGEG

Seg: seg
3-12 seg

GGGGGGGGEG

HMMPfam: PF03094
IPR004326
14-442 Mlo
Mlo-related protein

RQLDQTPTWAVSTVCGVIILISIILELIIHKVGEVFERKKKKALFEALEKIKNELMVLGFISLLLTFGQNYIASICVPSRYGHAMSFCGPYDGPSEDDRKKLKKTDHAMRILYSVQRRSLADAPPDYVALISLNALHQVHIFIFFLAVFHVIYSAITMMLGRAKIRGWKVWEQEVIHEQEMMNDPSRFRLTHETSFVREHVNSWASNKFFFYVMCFFRQILRSVRKSDYLTMRHGFISVHLAPGMKFDFQKYIKRSLEDDFKVVVGIRPELWAFVMLFLLFDVHGWYVTAVITMIPPLLTLAIGTKLQAIISYMALEIQERHAVIQGMPVVNVSDQHFWFEKPDLVLHMIHFVLFQYEFGLRSCFHHHFGLIIIRVCLGVGVQFLCSYITLPLYALVTQMGSTMKRSVFDEQTSKALEQWHKKARKKNE

HMMPfam: PF03094
IPR004326
14-442 Mlo
Mlo-related protein

RQLDQTPTWAVSTVCGVIILISIILELIIHKVGEVFERKKKKALFEALEKIKNELMVLGFISLLLTFGQNYIASICVPSRYGHAMSFCGPYDGPSEDDRKKLKKTDHAMRILYSVQRRSLADAPPDYVALISLNALHQVHIFIFFLAVFHVIYSAITMMLGRAKIRGWKVWEQEVIHEQEMMNDPSRFRLTHETSFVREHVNSWASNKFFFYVMCFFRQILRSVRKSDYLTMRHGFISVHLAPGMKFDFQKYIKRSLEDDFKVVVGIRPELWAFVMLFLLFDVHGWYVTAVITMIPPLLTLAIGTKLQAIISYMALEIQERHAVIQGMPVVNVSDQHFWFEKPDLVLHMIHFVLFQYEFGLRSCFHHHFGLIIIRVCLGVGVQFLCSYITLPLYALVTQMGSTMKRSVFDEQTSKALEQWHKKARKKNE

Seg: seg
31-42 seg

IILISIILELII

Seg: seg
31-42 seg

IILISIILELII

Seg: seg
52-65 seg

KKKKALFEALEKIK

Seg: seg
52-65 seg

KKKKALFEALEKIK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox