PRGDB00062174 (disease resistance protein, putative; 7647-10478)

From PRG Wiki
Jump to: navigation, search
disease resistance protein, putative; 7647-10478
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 12321862 (AC073395)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 3 BAC F11B9 genomic sequence, complete sequence.

DNA Sequence

ATGACAGGCTCTTGGAATCCAACGAGTATCATCATCCCTGTTACACTTTCCTTTCTCCTCTCATTCATTCACAATTTTGCGGACGTGGTTGCAGCTCCTACTAGGCACTTGTGTCTTCCCGAACAAAGGGATGCACTTCTCGAACTCAAGAACGAGTTTGAGATTGGGAAGCCTTCCTCTAATGATTATTGCTATCGCAATAATAGCCGTGTAAGCCCTCATCCGACGACAGAGTCATGGAGGAATAACAGCGACTGTTGTAATTGGGAGGGTATCACGTGTGATACCAAGTCCGGGGAAGTGATCGAGCTCGACCTTAGCTGCAGCTGGCTCTATGGCAGCTTTCATTCCAATAGCAGTCTTTTTAGGCTTCAAAACCTCCGTGTTCTAGACCTTACTCAAAATGATCTTGATGGTGAAATCCCTTCTTCAATCGGAAATCTTTCTCATCTCACCTCTCTCCACCTATCTTATAATCAGTTTTTGGGTCTGATTCCTTCTTCAATTGAAAACCTTTCTCGTCTCACCTCCCTCCACCTGTCTTCTAATCAGTTTTCAGGTCAAATCCCGTCCTCAATTGGAAACCTTTCTCATCTCACATCTCTCGAGCTTTCTTCTAATCAGTTTTCGGGTCAAATCCCGTCTTCAATTGGAAATCTTTCTAATCTCACCTTTCTCAGTCTCCCTAGTAATGATTTCTTTGGTCAGATTCCATCTTCGATTGGGAACCTTGCTCGTCTCACCTATCTCTACCTTTCTTACAACAATTTCGTTGGTGAAATCCCATCTTCTTTTGGCAATCTAAACCAGCTGATCGTCTTACAGGTTGATTCCAATAAGCTCAGTGGAAATGTTCCCATCTCACTACTGAATTTGACGAGGTTGTCTGCTTTATTACTTTCCCACAATCAGTTCACAGGCACGATTCCTAATAACATCAGTTTACTATCAAACTTGATGGACTTTGAAGCAAGTAACAACGCTTTCACTGGAACTCTCCCTTCTTCTCTCTTCAACATTCCTCCTTTGATTAGACTTGATTTGAGCGATAACCAACTCAACGGCACTCTTCATTTTGGGAATATATCTTCACCATCTAACCTACAATACCTTATCATTGGCAGCAACAACTTCATAGGGACAATCCCGAGATCTCTTTCCAGATTTGTCAACCTCACGCTTTTTGACCTTTCCCATTTAAACACCCAATGTCGCCCAGTTGACTTTAGTATCTTCTCGCATCTCAAGTCGCTTGACGATCTTAGGCTATCCTATTTGACCACCACTACGATTGACTTGAACGATATCTTACCATATTTCAAGACGCTCCGTTCATTGGATATCTCAGGCAACCTTGTTTCAGCCACAAACAAGTCTTCAGTTTCTTCAGATCCTCCTTCGCAATCGATACAATCTTTGTACTTGTCAGGATGCGGTATCACCGATTTTCCAGAGATCCTAAGAACACAACACGAATTGGGGTTTCTAGACGTTTCCAACAACAAAATCAAAGGTCAAGTTCCTGGCTGGTTATGGACGCTACCAAACTTGTTCTACTTGAATCTTTCCAACAACACTTTCATCAGTTTTGAAAGCTCGTCGAAGAAACATGGACTCTCCTCTGTCCGGAAACCATCTATGATTCACTTGTTTGCCTCCAACAACAACTTCACGGGCAAGATTCCTTCTTTCATATGCGGGTTGCGTTCTCTAAACACTCTGGATTTATCTGAAAACAACTATAATGGTTCAATCCCTCGTTGCATGGAAAAACTCAAGAGTACTCTTTTCGTTCTAAACCTTCGTCAAAATAATCTGAGTGGAGGTCTTCCAAAGCATATATTTGAAAGCCTAAGGTCGCTTGACGTCGGTCATAACCTACTGGTGGGAAAGCTTCCAAGATCTTTGATCCGTTTCTCTAATCTTGAAGTTTTGAACGTGGAAAGCAACAGAATCAACGACACGTTTCCGTTCTGGTTGAGTTCTCTGTCGAAGTTACAAGTTCTTGTATTACGCTCCAATGCATTCCATGGACCAATACATGAAGCCACATTCCCTGAGTTGCGAATCATTGACATATCACATAATCACTTCAATGGAACTTTGCCAACAGAGTACTTTGTGAAGTGGAGTGCTATGTCATCACTTGGAAAAAACGAAGACCAGTCTAACGAAAAGTACATGGGATCAGGCCTTTACTACCAAGATTCAATGGTTTTGATGAATAAAGGTTTAGCGATGGAGCTGGTACGTATTCTAACAATCTACACAGCACTCGACTTTTCCGGAAACAAATTTGAAGGAGAGATTCCAAAGTCCATTGGTCTATTGAAAGAGCTTCTCGTGCTCAACTTGTCAAACAATGCTTTTGGTGGCCACATCCCATCATCTATGGGGAACCTGACAGCTCTCGAGTCATTGGACGTTTCCCAGAACAAGCTTACAGGAGAGATTCCACAAGAGCTAGGGGACCTTTCGTTCCTTGCGTATATGAACTTCTCTCATAACCAGCTTGCAGGCCTAGTACCAGGAGGTACGCAGTTTCGAAGGCAAAATTGCTCTGCCTTTGAGAATAACCTGGGACTTTTTGGCCCTTCTCTTGACGAAGTCTGCAGAGATAAACATACGCCAGCATCACAACAGAATGAAACGACAGAAACAGAGGAAGAAGACGAAGAAGAGATAAGCTGGATAGCAGCCGCAATAGGATTCATACCTGGAATTGTCTTTGGATTAACGATTGGATACATATTGGTTTCCTACAAACCAGAGTGGTTCATGAACCCTTTTGGCCGAAACAATCGTCGACGCAGAAACACCACCACCCACTAG


Protein sequences

Name Description Sequence
disease resistance protein, putative; 7647-10478 disease resistance protein, putative; 7647-10478 [Arabidopsis thaliana].

MTGSWNPTSIIIPVTLSFLLSFIHNFADVVAAPTRHLCLPEQRDALLELKNEFEIGKPSSNDYCYRNNSRVSPHPTTESWRNNSDCCNWEGITCDTKSGEVIELDLSCSWLYGSFHSNSSLFRLQNLRVLDLTQNDLDGEIPSSIGNLSHLTSLHLSYNQFLGLIPSSIENLSRLTSLHLSSNQFSGQIPSSIGNLSHLTSLELSSNQFSGQIPSSIGNLSNLTFLSLPSNDFFGQIPSSIGNLARLTYLYLSYNNFVGEIPSSFGNLNQLIVLQVDSNKLSGNVPISLLNLTRLSALLLSHNQFTGTIPNNISLLSNLMDFEASNNAFTGTLPSSLFNIPPLIRLDLSDNQLNGTLHFGNISSPSNLQYLIIGSNNFIGTIPRSLSRFVNLTLFDLSHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDISGNLVSATNKSSVSSDPPSQSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTFISFESSSKKHGLSSVRKPSMIHLFASNNNFTGKIPSFICGLRSLNTLDLSENNYNGSIPRCMEKLKSTLFVLNLRQNNLSGGLPKHIFESLRSLDVGHNLLVGKLPRSLIRFSNLEVLNVESNRINDTFPFWLSSLSKLQVLVLRSNAFHGPIHEATFPELRIIDISHNHFNGTLPTEYFVKWSAMSSLGKNEDQSNEKYMGSGLYYQDSMVLMNKGLAMELVRILTIYTALDFSGNKFEGEIPKSIGLLKELLVLNLSNNAFGGHIPSSMGNLTALESLDVSQNKLTGEIPQELGDLSFLAYMNFSHNQLAGLVPGGTQFRRQNCSAFENNLGLFGPSLDEVCRDKHTPASQQNETTETEEEDEEEISWIAAAIGFIPGIVFGLTIGYILVSYKPEWFMNPFGRNNRRRRNTTTH

disease resistance protein, putative; 7647-10478 disease resistance protein, putative; 7647-10478 [Arabidopsis thaliana].

MTGSWNPTSIIIPVTLSFLLSFIHNFADVVAAPTRHLCLPEQRDALLELKNEFEIGKPSSNDYCYRNNSRVSPHPTTESWRNNSDCCNWEGITCDTKSGEVIELDLSCSWLYGSFHSNSSLFRLQNLRVLDLTQNDLDGEIPSSIGNLSHLTSLHLSYNQFLGLIPSSIENLSRLTSLHLSSNQFSGQIPSSIGNLSHLTSLELSSNQFSGQIPSSIGNLSNLTFLSLPSNDFFGQIPSSIGNLARLTYLYLSYNNFVGEIPSSFGNLNQLIVLQVDSNKLSGNVPISLLNLTRLSALLLSHNQFTGTIPNNISLLSNLMDFEASNNAFTGTLPSSLFNIPPLIRLDLSDNQLNGTLHFGNISSPSNLQYLIIGSNNFIGTIPRSLSRFVNLTLFDLSHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDISGNLVSATNKSSVSSDPPSQSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTFISFESSSKKHGLSSVRKPSMIHLFASNNNFTGKIPSFICGLRSLNTLDLSENNYNGSIPRCMEKLKSTLFVLNLRQNNLSGGLPKHIFESLRSLDVGHNLLVGKLPRSLIRFSNLEVLNVESNRINDTFPFWLSSLSKLQVLVLRSNAFHGPIHEATFPELRIIDISHNHFNGTLPTEYFVKWSAMSSLGKNEDQSNEKYMGSGLYYQDSMVLMNKGLAMELVRILTIYTALDFSGNKFEGEIPKSIGLLKELLVLNLSNNAFGGHIPSSMGNLTALESLDVSQNKLTGEIPQELGDLSFLAYMNFSHNQLAGLVPGGTQFRRQNCSAFENNLGLFGPSLDEVCRDKHTPASQQNETTETEEEDEEEISWIAAAIGFIPGIVFGLTIGYILVSYKPEWFMNPFGRNNRRRRNTTTH

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-938 PTHR24420,FAMILY NOT NAMED

MTGSWNPTSIIIPVTLSFLLSFIHNFADVVAAPTRHLCLPEQRDALLELKNEFEIGKPSSNDYCYRNNSRVSPHPTTESWRNNSDCCNWEGITCDTKSGEVIELDLSCSWLYGSFHSNSSLFRLQNLRVLDLTQNDLDGEIPSSIGNLSHLTSLHLSYNQFLGLIPSSIENLSRLTSLHLSSNQFSGQIPSSIGNLSHLTSLELSSNQFSGQIPSSIGNLSNLTFLSLPSNDFFGQIPSSIGNLARLTYLYLSYNNFVGEIPSSFGNLNQLIVLQVDSNKLSGNVPISLLNLTRLSALLLSHNQFTGTIPNNISLLSNLMDFEASNNAFTGTLPSSLFNIPPLIRLDLSDNQLNGTLHFGNISSPSNLQYLIIGSNNFIGTIPRSLSRFVNLTLFDLSHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDISGNLVSATNKSSVSSDPPSQSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTFISFESSSKKHGLSSVRKPSMIHLFASNNNFTGKIPSFICGLRSLNTLDLSENNYNGSIPRCMEKLKSTLFVLNLRQNNLSGGLPKHIFESLRSLDVGHNLLVGKLPRSLIRFSNLEVLNVESNRINDTFPFWLSSLSKLQVLVLRSNAFHGPIHEATFPELRIIDISHNHFNGTLPTEYFVKWSAMSSLGKNEDQSNEKYMGSGLYYQDSMVLMNKGLAMELVRILTIYTALDFSGNKFEGEIPKSIGLLKELLVLNLSNNAFGGHIPSSMGNLTALESLDVSQNKLTGEIPQELGDLSFLAYMNFSHNQLAGLVPGGTQFRRQNCSAFENNLGLFGPSLDEVCRDKHTPASQQNETTETEEEDEEEISWIAAAIGFIPGIVFGLTIGYILVSYKPEWFMNPFGRNNRRRR

HMMPanther: PTHR24420:SF911
1-938 PTHR24420:SF911

MTGSWNPTSIIIPVTLSFLLSFIHNFADVVAAPTRHLCLPEQRDALLELKNEFEIGKPSSNDYCYRNNSRVSPHPTTESWRNNSDCCNWEGITCDTKSGEVIELDLSCSWLYGSFHSNSSLFRLQNLRVLDLTQNDLDGEIPSSIGNLSHLTSLHLSYNQFLGLIPSSIENLSRLTSLHLSSNQFSGQIPSSIGNLSHLTSLELSSNQFSGQIPSSIGNLSNLTFLSLPSNDFFGQIPSSIGNLARLTYLYLSYNNFVGEIPSSFGNLNQLIVLQVDSNKLSGNVPISLLNLTRLSALLLSHNQFTGTIPNNISLLSNLMDFEASNNAFTGTLPSSLFNIPPLIRLDLSDNQLNGTLHFGNISSPSNLQYLIIGSNNFIGTIPRSLSRFVNLTLFDLSHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDISGNLVSATNKSSVSSDPPSQSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTFISFESSSKKHGLSSVRKPSMIHLFASNNNFTGKIPSFICGLRSLNTLDLSENNYNGSIPRCMEKLKSTLFVLNLRQNNLSGGLPKHIFESLRSLDVGHNLLVGKLPRSLIRFSNLEVLNVESNRINDTFPFWLSSLSKLQVLVLRSNAFHGPIHEATFPELRIIDISHNHFNGTLPTEYFVKWSAMSSLGKNEDQSNEKYMGSGLYYQDSMVLMNKGLAMELVRILTIYTALDFSGNKFEGEIPKSIGLLKELLVLNLSNNAFGGHIPSSMGNLTALESLDVSQNKLTGEIPQELGDLSFLAYMNFSHNQLAGLVPGGTQFRRQNCSAFENNLGLFGPSLDEVCRDKHTPASQQNETTETEEEDEEEISWIAAAIGFIPGIVFGLTIGYILVSYKPEWFMNPFGRNNRRRR

HMMPanther: PTHR24420
1-938 PTHR24420,FAMILY NOT NAMED

MTGSWNPTSIIIPVTLSFLLSFIHNFADVVAAPTRHLCLPEQRDALLELKNEFEIGKPSSNDYCYRNNSRVSPHPTTESWRNNSDCCNWEGITCDTKSGEVIELDLSCSWLYGSFHSNSSLFRLQNLRVLDLTQNDLDGEIPSSIGNLSHLTSLHLSYNQFLGLIPSSIENLSRLTSLHLSSNQFSGQIPSSIGNLSHLTSLELSSNQFSGQIPSSIGNLSNLTFLSLPSNDFFGQIPSSIGNLARLTYLYLSYNNFVGEIPSSFGNLNQLIVLQVDSNKLSGNVPISLLNLTRLSALLLSHNQFTGTIPNNISLLSNLMDFEASNNAFTGTLPSSLFNIPPLIRLDLSDNQLNGTLHFGNISSPSNLQYLIIGSNNFIGTIPRSLSRFVNLTLFDLSHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDISGNLVSATNKSSVSSDPPSQSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTFISFESSSKKHGLSSVRKPSMIHLFASNNNFTGKIPSFICGLRSLNTLDLSENNYNGSIPRCMEKLKSTLFVLNLRQNNLSGGLPKHIFESLRSLDVGHNLLVGKLPRSLIRFSNLEVLNVESNRINDTFPFWLSSLSKLQVLVLRSNAFHGPIHEATFPELRIIDISHNHFNGTLPTEYFVKWSAMSSLGKNEDQSNEKYMGSGLYYQDSMVLMNKGLAMELVRILTIYTALDFSGNKFEGEIPKSIGLLKELLVLNLSNNAFGGHIPSSMGNLTALESLDVSQNKLTGEIPQELGDLSFLAYMNFSHNQLAGLVPGGTQFRRQNCSAFENNLGLFGPSLDEVCRDKHTPASQQNETTETEEEDEEEISWIAAAIGFIPGIVFGLTIGYILVSYKPEWFMNPFGRNNRRRR

HMMPanther: PTHR24420:SF911
1-938 PTHR24420:SF911

MTGSWNPTSIIIPVTLSFLLSFIHNFADVVAAPTRHLCLPEQRDALLELKNEFEIGKPSSNDYCYRNNSRVSPHPTTESWRNNSDCCNWEGITCDTKSGEVIELDLSCSWLYGSFHSNSSLFRLQNLRVLDLTQNDLDGEIPSSIGNLSHLTSLHLSYNQFLGLIPSSIENLSRLTSLHLSSNQFSGQIPSSIGNLSHLTSLELSSNQFSGQIPSSIGNLSNLTFLSLPSNDFFGQIPSSIGNLARLTYLYLSYNNFVGEIPSSFGNLNQLIVLQVDSNKLSGNVPISLLNLTRLSALLLSHNQFTGTIPNNISLLSNLMDFEASNNAFTGTLPSSLFNIPPLIRLDLSDNQLNGTLHFGNISSPSNLQYLIIGSNNFIGTIPRSLSRFVNLTLFDLSHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDISGNLVSATNKSSVSSDPPSQSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTFISFESSSKKHGLSSVRKPSMIHLFASNNNFTGKIPSFICGLRSLNTLDLSENNYNGSIPRCMEKLKSTLFVLNLRQNNLSGGLPKHIFESLRSLDVGHNLLVGKLPRSLIRFSNLEVLNVESNRINDTFPFWLSSLSKLQVLVLRSNAFHGPIHEATFPELRIIDISHNHFNGTLPTEYFVKWSAMSSLGKNEDQSNEKYMGSGLYYQDSMVLMNKGLAMELVRILTIYTALDFSGNKFEGEIPKSIGLLKELLVLNLSNNAFGGHIPSSMGNLTALESLDVSQNKLTGEIPQELGDLSFLAYMNFSHNQLAGLVPGGTQFRRQNCSAFENNLGLFGPSLDEVCRDKHTPASQQNETTETEEEDEEEISWIAAAIGFIPGIVFGLTIGYILVSYKPEWFMNPFGRNNRRRR

superfamily: SSF52058
18-454 SSF52058,LRR

FLLSFIHNFADVVAAPTRHLCLPEQRDALLELKNEFEIGKPSSNDYCYRNNSRVSPHPTTESWRNNSDCCNWEGITCDTKSGEVIELDLSCSWLYGSFHSNSSLFRLQNLRVLDLTQNDLDGEIPSSIGNLSHLTSLHLSYNQFLGLIPSSIENLSRLTSLHLSSNQFSGQIPSSIGNLSHLTSLELSSNQFSGQIPSSIGNLSNLTFLSLPSNDFFGQIPSSIGNLARLTYLYLSYNNFVGEIPSSFGNLNQLIVLQVDSNKLSGNVPISLLNLTRLSALLLSHNQFTGTIPNNISLLSNLMDFEASNNAFTGTLPSSLFNIPPLIRLDLSDNQLNGTLHFGNISSPSNLQYLIIGSNNFIGTIPRSLSRFVNLTLFDLSHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDISGNLVS

superfamily: SSF52058
18-454 SSF52058,LRR

FLLSFIHNFADVVAAPTRHLCLPEQRDALLELKNEFEIGKPSSNDYCYRNNSRVSPHPTTESWRNNSDCCNWEGITCDTKSGEVIELDLSCSWLYGSFHSNSSLFRLQNLRVLDLTQNDLDGEIPSSIGNLSHLTSLHLSYNQFLGLIPSSIENLSRLTSLHLSSNQFSGQIPSSIGNLSHLTSLELSSNQFSGQIPSSIGNLSNLTFLSLPSNDFFGQIPSSIGNLARLTYLYLSYNNFVGEIPSSFGNLNQLIVLQVDSNKLSGNVPISLLNLTRLSALLLSHNQFTGTIPNNISLLSNLMDFEASNNAFTGTLPSSLFNIPPLIRLDLSDNQLNGTLHFGNISSPSNLQYLIIGSNNFIGTIPRSLSRFVNLTLFDLSHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDISGNLVS

HMMPfam: PF08263
IPR013210
40-95 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PEQRDALLELKNEFEIGKPSSNDYCYRNNSRVSPHPTTESWRNNSDCCNWEGITCD

HMMPfam: PF08263
IPR013210
40-95 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PEQRDALLELKNEFEIGKPSSNDYCYRNNSRVSPHPTTESWRNNSDCCNWEGITCD

Gene3D: G3DSA:3.80.10.10
69-242 G3DSA:3.80.10.10

SRVSPHPTTESWRNNSDCCNWEGITCDTKSGEVIELDLSCSWLYGSFHSNSSLFRLQNLRVLDLTQNDLDGEIPSSIGNLSHLTSLHLSYNQFLGLIPSSIENLSRLTSLHLSSNQFSGQIPSSIGNLSHLTSLELSSNQFSGQIPSSIGNLSNLTFLSLPSNDFFGQIPSSIG

Gene3D: G3DSA:3.80.10.10
69-242 G3DSA:3.80.10.10

SRVSPHPTTESWRNNSDCCNWEGITCDTKSGEVIELDLSCSWLYGSFHSNSSLFRLQNLRVLDLTQNDLDGEIPSSIGNLSHLTSLHLSYNQFLGLIPSSIENLSRLTSLHLSSNQFSGQIPSSIGNLSHLTSLELSSNQFSGQIPSSIGNLSNLTFLSLPSNDFFGQIPSSIG

HMMPfam: PF13855
126-184 LRR_8,Leucine rich repeat

NLRVLDLTQNDLDGEIPSSIGNLSHLTSLHLSYNQFLGLIPSSIENLSRLTSLHLSSNQ

HMMPfam: PF13855
126-184 LRR_8,Leucine rich repeat

NLRVLDLTQNDLDGEIPSSIGNLSHLTSLHLSYNQFLGLIPSSIENLSRLTSLHLSSNQ

HMMPfam: PF13516
196-219 LRR_6,Leucine Rich repeat

LSHLTSLELSSNQFSGQIPSSIGN

HMMPfam: PF13516
196-219 LRR_6,Leucine Rich repeat

LSHLTSLELSSNQFSGQIPSSIGN

Gene3D: G3DSA:3.80.10.10
243-462 G3DSA:3.80.10.10

NLARLTYLYLSYNNFVGEIPSSFGNLNQLIVLQVDSNKLSGNVPISLLNLTRLSALLLSHNQFTGTIPNNISLLSNLMDFEASNNAFTGTLPSSLFNIPPLIRLDLSDNQLNGTLHFGNISSPSNLQYLIIGSNNFIGTIPRSLSRFVNLTLFDLSHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDISGNLVSATNKSSVS

Gene3D: G3DSA:3.80.10.10
243-462 G3DSA:3.80.10.10

NLARLTYLYLSYNNFVGEIPSSFGNLNQLIVLQVDSNKLSGNVPISLLNLTRLSALLLSHNQFTGTIPNNISLLSNLMDFEASNNAFTGTLPSSLFNIPPLIRLDLSDNQLNGTLHFGNISSPSNLQYLIIGSNNFIGTIPRSLSRFVNLTLFDLSHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDISGNLVSATNKSSVS

HMMPfam: PF13855
246-304 LRR_8,Leucine rich repeat

RLTYLYLSYNNFVGEIPSSFGNLNQLIVLQVDSNKLSGNVPISLLNLTRLSALLLSHNQ

HMMPfam: PF13855
246-304 LRR_8,Leucine rich repeat

RLTYLYLSYNNFVGEIPSSFGNLNQLIVLQVDSNKLSGNVPISLLNLTRLSALLLSHNQ

FPrintScan: PR00019
343-356 LEURICHRPT,Leucine-rich repeat signature

LIRLDLSDNQLNGT

FPrintScan: PR00019
343-356 LEURICHRPT,Leucine-rich repeat signature

LIRLDLSDNQLNGT

Gene3D: G3DSA:3.80.10.10
468-605 G3DSA:3.80.10.10

QSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTFISFESSSKKHGLSSVRKPSMIHLFASNNNFTGKIPSFICGLRSLNTLDLSENNYNGSIPRCMEKLKSTLFVLNLRQNN

superfamily: SSF52058
468-859 SSF52058,LRR

QSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTFISFESSSKKHGLSSVRKPSMIHLFASNNNFTGKIPSFICGLRSLNTLDLSENNYNGSIPRCMEKLKSTLFVLNLRQNNLSGGLPKHIFESLRSLDVGHNLLVGKLPRSLIRFSNLEVLNVESNRINDTFPFWLSSLSKLQVLVLRSNAFHGPIHEATFPELRIIDISHNHFNGTLPTEYFVKWSAMSSLGKNEDQSNEKYMGSGLYYQDSMVLMNKGLAMELVRILTIYTALDFSGNKFEGEIPKSIGLLKELLVLNLSNNAFGGHIPSSMGNLTALESLDVSQNKLTGEIPQELGDLSFLAYMNFSHNQLAGLVPGGTQFRRQNCSAFENN

Gene3D: G3DSA:3.80.10.10
468-605 G3DSA:3.80.10.10

QSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTFISFESSSKKHGLSSVRKPSMIHLFASNNNFTGKIPSFICGLRSLNTLDLSENNYNGSIPRCMEKLKSTLFVLNLRQNN

superfamily: SSF52058
468-859 SSF52058,LRR

QSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTFISFESSSKKHGLSSVRKPSMIHLFASNNNFTGKIPSFICGLRSLNTLDLSENNYNGSIPRCMEKLKSTLFVLNLRQNNLSGGLPKHIFESLRSLDVGHNLLVGKLPRSLIRFSNLEVLNVESNRINDTFPFWLSSLSKLQVLVLRSNAFHGPIHEATFPELRIIDISHNHFNGTLPTEYFVKWSAMSSLGKNEDQSNEKYMGSGLYYQDSMVLMNKGLAMELVRILTIYTALDFSGNKFEGEIPKSIGLLKELLVLNLSNNAFGGHIPSSMGNLTALESLDVSQNKLTGEIPQELGDLSFLAYMNFSHNQLAGLVPGGTQFRRQNCSAFENN

HMMPfam: PF13855
469-525 LRR_8,Leucine rich repeat

SIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNN

HMMPfam: PF13855
469-525 LRR_8,Leucine rich repeat

SIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNN

Gene3D: G3DSA:3.80.10.10
606-718 G3DSA:3.80.10.10

LSGGLPKHIFESLRSLDVGHNLLVGKLPRSLIRFSNLEVLNVESNRINDTFPFWLSSLSKLQVLVLRSNAFHGPIHEATFPELRIIDISHNHFNGTLPTEYFVKWSAMSSLGK

Gene3D: G3DSA:3.80.10.10
606-718 G3DSA:3.80.10.10

LSGGLPKHIFESLRSLDVGHNLLVGKLPRSLIRFSNLEVLNVESNRINDTFPFWLSSLSKLQVLVLRSNAFHGPIHEATFPELRIIDISHNHFNGTLPTEYFVKWSAMSSLGK

HMMPfam: PF13855
617-675 LRR_8,Leucine rich repeat

SLRSLDVGHNLLVGKLPRSLIRFSNLEVLNVESNRINDTFPFWLSSLSKLQVLVLRSNA

HMMPfam: PF13855
617-675 LRR_8,Leucine rich repeat

SLRSLDVGHNLLVGKLPRSLIRFSNLEVLNVESNRINDTFPFWLSSLSKLQVLVLRSNA

Gene3D: G3DSA:3.80.10.10
759-859 G3DSA:3.80.10.10

LDFSGNKFEGEIPKSIGLLKELLVLNLSNNAFGGHIPSSMGNLTALESLDVSQNKLTGEIPQELGDLSFLAYMNFSHNQLAGLVPGGTQFRRQNCSAFENN

Gene3D: G3DSA:3.80.10.10
759-859 G3DSA:3.80.10.10

LDFSGNKFEGEIPKSIGLLKELLVLNLSNNAFGGHIPSSMGNLTALESLDVSQNKLTGEIPQELGDLSFLAYMNFSHNQLAGLVPGGTQFRRQNCSAFENN

FPrintScan: PR00019
801-814 LEURICHRPT,Leucine-rich repeat signature

LTALESLDVSQNKL

FPrintScan: PR00019
801-814 LEURICHRPT,Leucine-rich repeat signature

LTALESLDVSQNKL

HMMPfam: PF13516
802-823 LRR_6,Leucine Rich repeat

TALESLDVSQNKLTGEIPQELG

HMMPfam: PF13516
802-823 LRR_6,Leucine Rich repeat

TALESLDVSQNKLTGEIPQELG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox