PRGDB00062176 (non-race specific disease resistance protein 1-like protein a)

From PRG Wiki
Jump to: navigation, search
non-race specific disease resistance protein 1-like protein a
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 86155936 (DQ335596)
Gene Class Unknown
Domain Type
Gene Species Coffea arabica

Comment?

Coffea arabica non-race specific disease resistance protein 1-like protein a (NDR1a) mRNA, complete cds.

DNA Sequence

ATGTCAGACCCCAGCAGCAGTGCAGGAGGGTGTTGCCGATGCTGCTGCAGCTTCATATTGACCTCAGGCCTAACAGCCCTTTTCATGTGGCTAAGTCTTCGTGGGTCTAAACCCTCATGCTCCATAGAAGACTTTTATGTTCCTTCCCTGAATGCAACAGATAATTCCACCACTACTAGAAGCAACCACACTCTTTACTTTGATCTGAGGTTCAAGAATGAAATGAAGGACAAAGGTGTAGGCTATGATGATCTGAATCTCACCTTCTTTTATGTTCAAAATGGTAGCCTTGGAATAGCAAACTATACCGTCCCAAGTTTCTACCAGGGTCATGACAAGAAAGCTCGCCGGAAAGAGCTGGTGCAGACATATGGGGTGCCATGGGAGGCTGCTTACAGGGCGGTGTCAAATGGGTCCACGGTGACTTTCCGGGTGGGATTGACCACTAGGGTGAGGTACAAGATTCTTTTTTGGTATACCAAGAGACATGGCTTGAAGGTGGGGGCTAATGTGGATGTCAATAATTCTGGTAAAAAGGTCAACAAGAAGGGCATCAGACTCAAGTCCGGCGCCCCGGAGTCGGTTCGCTGTCCTGGGCTAGTGGTAATTTCGATTGCATTGTATTTCTTGGTTCTGCTGTTGTAG


Protein sequences

Name Description Sequence
non-race specific disease resistance protein 1-like protein a non-race specific disease resistance protein 1-like protein a [Coffea arabica].

MSDPSSSAGGCCRCCCSFILTSGLTALFMWLSLRGSKPSCSIEDFYVPSLNATDNSTTTRSNHTLYFDLRFKNEMKDKGVGYDDLNLTFFYVQNGSLGIANYTVPSFYQGHDKKARRKELVQTYGVPWEAAYRAVSNGSTVTFRVGLTTRVRYKILFWYTKRHGLKVGANVDVNNSGKKVNKKGIRLKSGAPESVRCPGLVVISIALYFLVLLL

non-race specific disease resistance protein 1-like protein a non-race specific disease resistance protein 1-like protein a [Coffea arabica].

MSDPSSSAGGCCRCCCSFILTSGLTALFMWLSLRGSKPSCSIEDFYVPSLNATDNSTTTRSNHTLYFDLRFKNEMKDKGVGYDDLNLTFFYVQNGSLGIANYTVPSFYQGHDKKARRKELVQTYGVPWEAAYRAVSNGSTVTFRVGLTTRVRYKILFWYTKRHGLKVGANVDVNNSGKKVNKKGIRLKSGAPESVRCPGLVVISIALYFLVLLL







List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox