PRGDB00062178 (disease resistance protein Gpa2)

From PRG Wiki
Jump to: navigation, search
disease resistance protein Gpa2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 6164968 (AF195939)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Solanum tuberosum

Comment?

Solanum tuberosum disease resistance protein Gpa2 gene, complete cds.

DNA Sequence

ATGGCTTATGCTGCTGTTACTTCCCTTATGAGAACCATACATCAATCAATGGAACTTACTGGATGTGATTTGCAACCGTTTTATGAAAAGCTCAAATCTTTGAGAGCTATTCTGGAGAAATCCTGCAATATAATGGGCGATCATGAGGGGTTAACAATCTTGGAAGTTGAAATCATAGAGGTAGCATACACAACAGAAGATATGGTTGACTCGGAATCAAGAAATGTTTTTTTAGCACGGAATGTGGGGAAAAGAAGCAGGGCTATGTGGGGGATTTTTTTCGTCTTGGAACAAGCACTAGAATGCATTGATTCCACCGTGAAACAGTGGATGGCAACATCGGACAGCATGAAAGATCTAAAACCACAAACTAGCTCACTTGTCAGTTTACCTGAACATGATGTTGAGCAGCCCGAGAATATAATGGTTGGCCGTGAAAATGAATTTGAGATGATGCTGGATCAACTTGCTAGAGGAGGAAGGGAACTAGAAGTTGTCTCAATCGTAGGGATGGGAGGCATCGGGAAAACAACTTTGGCTGCAAAACTCTATAGTGATCCTTACATTATGTCTCGATTTGATATTCGTGCAAAAGCAACTGTTTCACAAGAGTATTGTGTGAGAAATGTACTCCTAGGCCTTCTTTCTTTGACAAGTGATGAACCTGATTATCAGCTAGCGGACCAACTGCAAAAGCATCTGAAAGGCAGGAGATACTTGGTAGTCATTGATGACATATGGACTACAGAAGCTTGGGATGATATAAAACTATGTTTCCCAGACTGCGATAATGGAAGCAGAATACTCCTGACTACTCGGAATGTGGAAGTGGCTGAATATGCTAGCTCAGGTAAGCCTCCTCATCACATGCGCCTCATGAATTTTGACGAAAGTTGGAATTTACTACACAAAAAGATCTTTGAAAAAGAAGGTTCTTATTCTCCTGAATTTGAAAATATTGGGAAACAAATTGCATTAAAATGTGGAGGGTTACCTCTAGCAATTACTTTGATTGCTGGACTTCTCTCCAAAATCAGTAAAACATTGGATGAGTGGCAAAATGTTGCGGAGAATGTACGTTCGGTGGTAAGCACAGATCTTGAAGCAAAATGCATGAGAGTGTTGGCTTTGAGTTACCATCACTTGCCTTCTCACCTAAAACCGTGTTTTCTGTATTTTGCAATTTTCGCAGAGGATGAACGGATTTATGTAAATAAACTTGTTGAGTTATGGGCCGTAGAGGGGTTTTTGAATGAAGAAGAGGGAAAAAGCATAGAAGAGGTGGCAGAAACATGTATAAACGAACTTGTAGATAGAAGTCTAATTTCTATCCACAATGTGAGTTTTGATGGGGAAACACAGAGATGTGGAATGCATGATGTGACCCGTGAACTCTGTTTGAGGGAAGCTCGAAACATGAATTTTGTGAATGTTATCAGAGGAAAGAGTGATCAAAATTCATGTGCACAATCCATGCAGTGTTCCTTTAAGAGTCGAAGTCGGATCAGTATCCATAATGAGGAAGAATTGGTTTGGTGTCGTAACAGCGAGGCTCATTCTATCATCACGTTGTGTATATTCAAATGCGTCACACTGGAATTGTCTTTCAAGCTAGTAAGAGTACTAGATCTTGGTTTGACTACATGCCCAATTTTTCCCAGTGGAGTACTTTCTCTAATTCATTTGAGATACCTATCTTTGCGTTTTAATCCTCGCTTACAGCAGTATCGAGGATCGAAAGAAGCTGTTCCCTCATCAATAATAGACATTCCTCTATCGATATCAAGCCTATGCTATCTGCAAACTTTTAAACTTTACCATCCATTTCCCAATTGTTATCCTTTCATATTACCATCGGAAATTTTGACAATGCCACAATTGAGGAAGCTGTGTATGGGCTGGAATTACTTGCGGAGTCATGAGCCTACAGAGAACAGATTGGTTTTGAAAAGTTTGCAATGCCTCAATGAATTGAATCCTCGGTATTGTACAGGGTCTTTTTTAAGACTATTTCCCAATTTAAAGAAGTTGGAAGTATTTGGCGTCAAAGAGGACTTTCGCAATCACAAGGACCTGTATGATTTTCGCTACTTATATCAGCTCGAGAAATTGGCATTTAGTACTTATTATTCATCTTCTGCTTGCTTTCTAAAAAACACTGCACCTTTAGGTTCTACTCCGCAAGATCCTCTGAGGTTTCAGATGGAAACATTGCACTTAGAGACTCATTCCAGGGCAACTGCACCTCCAACTGATGTTCCAACTTTCCTCTTACCTCCTCCGGATTGTTTTCCACAAAACCTTAAGAGTTTAACTTTTAGCGGAGATTTCTTTTTGGCATGGAAGGATTTGAGCATTGTTGGTAAATTACCCAAACTCGAGGTCCTTCAACTATCACACAATGCCTTCAAAGGCGAGGAGTGGGAAGTAGTTGAGGAAGGGTTTCCTCACTTGAAGTTCTTGTTTCTGGATAGCATATACATTCGGTACTGGAGAGCTAGTAGTGATCACTTTCCATACCTTGAACGACTTTTTCTTAGCGATTGCTTTTATTTGGATTCAATCCCTCGAGATTTTGCAGATATAACCACACTAGCTCTTATTGATATATTTCGCTGCCAACAATCTGTTGGGAATTCCGCCAAGCAAATTCAACAGGACATTCAAGACAACTATGGAAGCTCTATCGAGGTCCATACTCGTTATCTTTATCGAAATGGAGCATTTTTGGTAGTGTGA


Protein sequences

Name Description Sequence
disease resistance protein Gpa2 disease resistance protein Gpa2 [Solanum tuberosum].

MAYAAVTSLMRTIHQSMELTGCDLQPFYEKLKSLRAILEKSCNIMGDHEGLTILEVEIIEVAYTTEDMVDSESRNVFLARNVGKRSRAMWGIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSLPEHDVEQPENIMVGRENEFEMMLDQLARGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEPDYQLADQLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCDNGSRILLTTRNVEVAEYASSGKPPHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITLIAGLLSKISKTLDEWQNVAENVRSVVSTDLEAKCMRVLALSYHHLPSHLKPCFLYFAIFAEDERIYVNKLVELWAVEGFLNEEEGKSIEEVAETCINELVDRSLISIHNVSFDGETQRCGMHDVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQCSFKSRSRISIHNEEELVWCRNSEAHSIITLCIFKCVTLELSFKLVRVLDLGLTTCPIFPSGVLSLIHLRYLSLRFNPRLQQYRGSKEAVPSSIIDIPLSISSLCYLQTFKLYHPFPNCYPFILPSEILTMPQLRKLCMGWNYLRSHEPTENRLVLKSLQCLNELNPRYCTGSFLRLFPNLKKLEVFGVKEDFRNHKDLYDFRYLYQLEKLAFSTYYSSSACFLKNTAPLGSTPQDPLRFQMETLHLETHSRATAPPTDVPTFLLPPPDCFPQNLKSLTFSGDFFLAWKDLSIVGKLPKLEVLQLSHNAFKGEEWEVVEEGFPHLKFLFLDSIYIRYWRASSDHFPYLERLFLSDCFYLDSIPRDFADITTLALIDIFRCQQSVGNSAKQIQQDIQDNYGSSIEVHTRYLYRNGAFLVV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF129
1-480 PTHR11017:SF129

MAYAAVTSLMRTIHQSMELTGCDLQPFYEKLKSLRAILEKSCNIMGDHEGLTILEVEIIEVAYTTEDMVDSESRNVFLARNVGKRSRAMWGIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSLPEHDVEQPENIMVGRENEFEMMLDQLARGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEPDYQLADQLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCDNGSRILLTTRNVEVAEYASSGKPPHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITLIAGLLSKISKTLDEWQNVAENVRSVVSTDLEAKCMRVLALSYHHLPSHLKPCFLYFAIFAEDERIYVNKLVELWAVEGFLNEEEGKSIEEVAETCINELVDRSLISIHNVSFDGETQRCGMHDVTRELCLREARNMNFVNVIR

HMMPanther: PTHR11017
1-480 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MAYAAVTSLMRTIHQSMELTGCDLQPFYEKLKSLRAILEKSCNIMGDHEGLTILEVEIIEVAYTTEDMVDSESRNVFLARNVGKRSRAMWGIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSLPEHDVEQPENIMVGRENEFEMMLDQLARGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEPDYQLADQLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCDNGSRILLTTRNVEVAEYASSGKPPHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITLIAGLLSKISKTLDEWQNVAENVRSVVSTDLEAKCMRVLALSYHHLPSHLKPCFLYFAIFAEDERIYVNKLVELWAVEGFLNEEEGKSIEEVAETCINELVDRSLISIHNVSFDGETQRCGMHDVTRELCLREARNMNFVNVIR

superfamily: SSF52540
117-367 SSF52540

MKDLKPQTSSLVSLPEHDVEQPENIMVGRENEFEMMLDQLARGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEPDYQLADQLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCDNGSRILLTTRNVEVAEYASSGKPPHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITLIAGLLSKISKTLDEWQNVAENVRSVVSTDL

HMMPfam: PF00931
IPR002182
145-420 NB-ARC,NBS
NB-ARC

RENEFEMMLDQLARGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEPDYQLADQLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCDNGSRILLTTRNVEVAEYASSGKPPHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITLIAGLLSKISKTLDEWQNVAENVRSVVSTDLEAKCMRVLALSYHHLPSHLKPCFLYFAIFAEDERIYVNKLVELWAVEGFLNEE

Gene3D: G3DSA:3.40.50.300
150-278 G3DSA:3.40.50.300

EMMLDQLARGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEPDYQLADQLQKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCDNGSRILLTTRNVEVA

FPrintScan: PR00364
IPR000767
165-180 DISEASERSIST
Disease resistance protein

VVSIVGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
233-247 DISEASERSIST
Disease resistance protein

HLKGRRYLVVIDDIW

FPrintScan: PR00364
IPR000767
328-342 DISEASERSIST
Disease resistance protein

CGGLPLAITLIAGLL

superfamily: SSF52058
457-874 SSF52058,LRR

GMHDVTRELCLREARNMNFVNVIRGKSDQNSCAQSMQCSFKSRSRISIHNEEELVWCRNSEAHSIITLCIFKCVTLELSFKLVRVLDLGLTTCPIFPSGVLSLIHLRYLSLRFNPRLQQYRGSKEAVPSSIIDIPLSISSLCYLQTFKLYHPFPNCYPFILPSEILTMPQLRKLCMGWNYLRSHEPTENRLVLKSLQCLNELNPRYCTGSFLRLFPNLKKLEVFGVKEDFRNHKDLYDFRYLYQLEKLAFSTYYSSSACFLKNTAPLGSTPQDPLRFQMETLHLETHSRATAPPTDVPTFLLPPPDCFPQNLKSLTFSGDFFLAWKDLSIVGKLPKLEVLQLSHNAFKGEEWEVVEEGFPHLKFLFLDSIYIRYWRASSDHFPYLERLFLSDCFYLDSIPRDFADITTLALIDIFRCQ

Gene3D: G3DSA:3.80.10.10
535-677 G3DSA:3.80.10.10

SFKLVRVLDLGLTTCPIFPSGVLSLIHLRYLSLRFNPRLQQYRGSKEAVPSSIIDIPLSISSLCYLQTFKLYHPFPNCYPFILPSEILTMPQLRKLCMGWNYLRSHEPTENRLVLKSLQCLNELNPRYCTGSFLRLFPNLKKL

Gene3D: G3DSA:3.80.10.10
768-876 G3DSA:3.80.10.10

LKSLTFSGDFFLAWKDLSIVGKLPKLEVLQLSHNAFKGEEWEVVEEGFPHLKFLFLDSIYIRYWRASSDHFPYLERLFLSDCFYLDSIPRDFADITTLALIDIFRCQQS

FPrintScan: PR00364
IPR000767
788-804 DISEASERSIST
Disease resistance protein

GKLPKLEVLQLSHNAFK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox