PRGDB00062187 (putative NBS-LRR type disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative NBS-LRR type disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 5817334 (AF123695)
Gene Class N
Domain Type NBS
Gene Species Pisum sativum

Comment?

Pisum sativum putative NBS-LRR type disease resistance protein (RGA1.1) gene, partial cds.

DNA Sequence

CCTAGCACAAGTTGTTTACAATGATATAAAAGTTGAACAACATTTTGATCTCAAAGCATGGATTTGTGTATCCGAGGATTTCAATGTTGTTAGAATAACCAAGTCTCTCCTTGAATGTGTTGTTAGAAATACAACATCCGTTAATTCAAATGTCTGGGAAAGTGATAATCTTGATATCCTTCAAGTTGAATTAATGAAACATTTGATGGATAAAAGATTTTTGTTTGTGTTGGACGACATATGGAATGACAGTTATATTGATTGGGATGATTTGATGACACCCTTGAGTAATCGAGGAGCTGGAAGCATGGTGATCATAACGACACGGGAACAAAAAGTTGCAGAGGTTGCACACACATTTCCAATTCAGAAATTAGAACCTCTATCTGATGAAGACTGTTGGTCTTTACTCTCAAAGCATGCATTTGGCAATGAAGACCATGTTCGCGATAAATACCAAAACCTAGAAGAAATTGGCAGGAAGATTGCTAGAAAATGCGGT


Protein sequences

Name Description Sequence
putative NBS-LRR type disease resistance protein putative NBS-LRR type disease resistance protein [Pisum sativum].

LAQVVYNDIKVEQHFDLKAWICVSEDFNVVRITKSLLECVVRNTTSVNSNVWESDNLDILQVELMKHLMDKRFLFVLDDIWNDSYIDWDDLMTPLSNRGAGSMVIITTREQKVAEVAHTFPIQKLEPLSDEDCWSLLSKHAFGNEDHVRDKYQNLEEIGRKIARKCG

putative NBS-LRR type disease resistance protein putative NBS-LRR type disease resistance protein [Pisum sativum].

LAQVVYNDIKVEQHFDLKAWICVSEDFNVVRITKSLLECVVRNTTSVNSNVWESDNLDILQVELMKHLMDKRFLFVLDDIWNDSYIDWDDLMTPLSNRGAGSMVIITTREQKVAEVAHTFPIQKLEPLSDEDCWSLLSKHAFGNEDHVRDKYQNLEEIGRKIARKCG

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-166 NB-ARC,NBS
NB-ARC

LAQVVYNDIKVEQHFDLKAWICVSEDFNVVRITKSLLECVVRNTTSVNSNVWESDNLDILQVELMKHLMDKRFLFVLDDIWNDSYIDWDDLMTPLSNRGAGSMVIITTREQKVAEVAHTFPIQKLEPLSDEDCWSLLSKHAFGNEDHVRDKYQNLEEIGRKIARKC

superfamily: SSF52540
1-167 SSF52540

LAQVVYNDIKVEQHFDLKAWICVSEDFNVVRITKSLLECVVRNTTSVNSNVWESDNLDILQVELMKHLMDKRFLFVLDDIWNDSYIDWDDLMTPLSNRGAGSMVIITTREQKVAEVAHTFPIQKLEPLSDEDCWSLLSKHAFGNEDHVRDKYQNLEEIGRKIARKCG

HMMPfam: PF00931
IPR002182
1-166 NB-ARC,NBS
NB-ARC

LAQVVYNDIKVEQHFDLKAWICVSEDFNVVRITKSLLECVVRNTTSVNSNVWESDNLDILQVELMKHLMDKRFLFVLDDIWNDSYIDWDDLMTPLSNRGAGSMVIITTREQKVAEVAHTFPIQKLEPLSDEDCWSLLSKHAFGNEDHVRDKYQNLEEIGRKIARKC

superfamily: SSF52540
1-167 SSF52540

LAQVVYNDIKVEQHFDLKAWICVSEDFNVVRITKSLLECVVRNTTSVNSNVWESDNLDILQVELMKHLMDKRFLFVLDDIWNDSYIDWDDLMTPLSNRGAGSMVIITTREQKVAEVAHTFPIQKLEPLSDEDCWSLLSKHAFGNEDHVRDKYQNLEEIGRKIARKCG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox