PRGDB00062189 (disease resistance protein I2)

From PRG Wiki
Jump to: navigation, search
disease resistance protein I2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 4689222 (AF118127)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Solanum lycopersicum

Comment?

Lycopersicon esculentum disease resistance protein I2 (I2) gene, complete cds.

DNA Sequence

ATGGAGATTGGCTTAGCAGTTGGTGGTGCATTTCTCTCCTCAGCTTTGAATGTTCTGTTTGATAGGCTTGCTCCTAACGGTGATCTGCTCAACATGTTTCGGAAGCATAAGGATCATGTTAAGCTCTTAAAGAAGCTGAAAATGACTTTGCGTGGTATTCAGATTGTGCTAAGTGATGCAGAGAATAAGCAAGCATCAAATCCATCTGTGAGAGACTGGCTTAATGAGCTTCGAGATGCTGTCGACTCTGCTGAAAATTTAATAGAAGAAGTCAATTATGAAGCTTTGAGGCTTAAGGTGGAAGGTCAGCATCAGAATTTTTCAGAAACAAGCAACCAGCAAGTAAGTGATGATTTTTTCCTTAACATAAAGGACAAGCTGGAAGACACTATTGAAACATTAAAGGATTTGCAAGAGCAAATTGGTCTCCTTGGCTTAAAGGAGTATTTTGATTCCACGAAACTAGAAACTAGAAGACCTTCAACTTCTGTGGATGATGAATCTGATATCTTTGGTAGGCAGAGCGAAATAGAGGATTTGATTGACCGTCTATTGTCTGAAGGTGCAAGTGGGAAAAAGCTGACAGTAGTTCCTATCGTTGGAATGGGCGGCCAGGGCAAGACAACACTTGCTAAAGCCGTATACAATGATGAGAGGGTGAAGAATCATTTTGATTTGAAAGCGTGGTATTGCGTTTCTGAAGGATTTGATGCTTTGAGAATAACAAAAGAATTACTCCAAGAAATTGGCAAATTTGACTCGAAGGATGTCCACAACAATCTTAACCAGCTTCAAGTCAAATTGAAGGAAAGTTTGAAGGGAAAGAAGTTCCTTATTGTTTTGGATGATGTGTGGAATGAAAATTACAACGAGTGGAATGACTTGAGAAATATTTTTGCACAAGGAGATATAGGAAGTAAGATCATTGTGACGACACGCAAAGACAGTGTTGCCTTGATGATGGGAAATGAGCAAATTCGCATGGGCAATTTGTCTACCGAAGCCTCTTGGTCTTTATTTCAAAGACATGCATTTGAAAACATGGATCCTATGGGACATCCGGAACTTGAAGAGGTCGGAAGACAAATTGCAGCCAAGTGCAAAGGACTGCCCTTAGCTCTGAAGACGCTCGCTGGCATGTTACGCTCCAAATCAGAGGTTGAAGAGTGGAAACGTATTTTGAGAAGTGAAATATGGGAGCTGCCACACAATGACATATTACCAGCGTTGATGTTGAGCTACAATGATCTTCCCGCACATTTAAAGCGATGCTTTTCTTTTTGTGCAATATTTCCTAAAGATTATCCATTTAGGAAAGAACAAGTTATTCATCTATGGATTGCCAATGGTCTCGTACCAGTGAAAGATGAAATAAATCAAGATTTAGGCAACCAATACTTTCTAGAGTTGAGATCAAGATCATTATTTGAAAAGGTCCCAAATCCTTCTAAAAGGAACATAGAGGAATTATTCCTTATGCATGACCTTGTCAATGATTTAGCCCAACTTGCATCTTCAAAACTTTGTATCAGGTTAGAAGAGAGCCAAGGATCTCATATGTTGGAACAATGTCGGCACTTATCTTATTCAATAGGATTTAATGGTGAGTTTAAGAAATTGACACCCCTCTACAAATTGGAGCAGTTGAGGACATTGCTTCCGATACGTATTGAATTCAGATTGCACAATCTAAGCAAGAGGGTGTTGCATAACATACTGCCTACACTAAGATCCTTGAGGGCCCTATCATTCTCTCAATACAAGATTAAGGAGTTGCCAAATGACTTGTTTACCAAATTAAAGCTCCTCAGATTTTTGGATATTTCTCGGACATGGATTACAAAGTTGCCGGATTCCATTTGTGGATTATATAACTTGGAGACACTTCTCCTGTCATCTTGTGCTGATCTTGAGGAGCTACCGCTGCAGATGGAGAAGTTGATTAACTTGCGTCATCTTGACGTAAGCAACACTCGGCGCTTGAAGATGCCACTACATCTGAGCAGGTTGAAAAGCCTCCAAGTGTTGGTGGGACCCAAGTTTTTTGTAGATGGTTGGAGAATGGAAGATTTGGGTGAAGCACAAAACTTACATGGATCTCTATCAGTTGTGAAGTTGGAAAATGTGGTTGATAGAAGGGAAGCTGTGAAGGCAAAGATGAGGGAGAAGAATCATGTTGAGCAATTATCATTGGAGTGGAGTGAAAGTAGTATTGCCGACAATTCACAAACAGAAAGTGACATACTTGATGAGCTATGCCCACATAAAAACATCAAAAAAGTCGAAATCAGTGGATATAGAGGGACAAACTTTCCCAATTGGGTAGCTGATCCTTTGTTTCTTAAGCTGGTGAATTTGTCTCTAAGAAACTGCAAGGACTGTTACTCCTTGCCAGCACTAGGACAACTCCCTTGTTTGAAATTCCTTTCCGTTAAAGGGATGCATGGAATAAGAGTGGTGACGGAAGAATTCTATGGCAGATTGTCCTCCAAAAAGCCTTTTAACTCTCTAGAGAAGCTTGAATTTGAAGATATGACGGAGTGGAAGCAATGGCACGCACTAGGAATTGGAGAGTTCCCTACACTTGAGAACCTTTCAATTAAAAATTGCCCTGAGCTCAGTTTGGAGATACCCATCCAATTTTCAAGTTTAAAAAGGTTAGAAGTTAGTGATTGTCCAGTTGTTTTTGATGATGCCCAACTGTTTAGATCCCAACTTGAGGCAATGAAGCAGATTGAGGAAATAGATATATGTGATTGTAACTCTGTTACCTCCTTTCCTTTTAGCATACTGCCAACTACCTTGAAGAGAATACAGATATCTCGTTGCCCAAAATTGAAATTGGAGGCGCCAGTTGGTGAGATGTTTGTGGAGTATTTGAGAGTGAATGATTGTGGTTGTGTAGATGATATATCACCTGAGTTTCTCCCAACAGCACGTCAATTGAGTATTGAAAATTGCCAGAACGTTACTAGGTTTTTGATTCCTACTGCCACTGAAACTCTCCGTATTTCGAATTGTGAGAATGTTGAAAAACTATCGGTGGCATGTGGAGGAGCGGCCCAGATGACGTCACTGAATATTTGGGGATGTAAGAAGCTCAAGTGTCTTCCAGAACTCCTTCCATCTCTCAAGGAACTGCGTCTGTCTGATTGTCCAGAAATAGAAGGAGAATTGCCCTTCAATTTAGAAATACTCCGTATCATATATTGCAAGAAACTGGTGAATGGCCGAAAGGAGTGGCATTTACAGAGACTCACAGAGTTATGGATCGATCATGATGGGAGTGACGAAGATATTGAACATTGGGAGTTGCCTTGTTCTATTCAGAGACTTACCATAAAGAATCTTAAAACATTAAGCAGCCAACATCTCAAAAGCCTCACCTCTCTTCAATATCTATGTATTGAGGGTTATTTATCTCAGATTCAGTCACAAGGCCAGCTTTCCTCCTTTTCTCACCTCACTTCGCTTCAAACTCTACAAATCTGGAATTTCCTTAATCTCCAATCACTTGCTGAATCAGCACTGCCCTCCTCCCTCTCTCACCTGGAGATAGATGATTGCCCTAATCTCCAATCACTCTTCGAATCAGCACTGCCCTCCTCCCTCTCTCAGCTGTTCATCCAGGATTGCCCTAATCTCCAATCCCTTCCATTTAAAGGGATGCCCTCTTCCCTCTCTAAACTATCTATTTTCAATTGCCCATTGCTCACACCACTACTAGAATTTGACAAGGGGGAATACTGGCCACAAATTGCTCATATTCCCATCATAAATATCGATTGGAAATATATTTAA


Protein sequences

Name Description Sequence
disease resistance protein I2 disease resistance protein I2 [Solanum lycopersicum].

MEIGLAVGGAFLSSALNVLFDRLAPNGDLLNMFRKHKDHVKLLKKLKMTLRGIQIVLSDAENKQASNPSVRDWLNELRDAVDSAENLIEEVNYEALRLKVEGQHQNFSETSNQQVSDDFFLNIKDKLEDTIETLKDLQEQIGLLGLKEYFDSTKLETRRPSTSVDDESDIFGRQSEIEDLIDRLLSEGASGKKLTVVPIVGMGGQGKTTLAKAVYNDERVKNHFDLKAWYCVSEGFDALRITKELLQEIGKFDSKDVHNNLNQLQVKLKESLKGKKFLIVLDDVWNENYNEWNDLRNIFAQGDIGSKIIVTTRKDSVALMMGNEQIRMGNLSTEASWSLFQRHAFENMDPMGHPELEEVGRQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRKEQVIHLWIANGLVPVKDEINQDLGNQYFLELRSRSLFEKVPNPSKRNIEELFLMHDLVNDLAQLASSKLCIRLEESQGSHMLEQCRHLSYSIGFNGEFKKLTPLYKLEQLRTLLPIRIEFRLHNLSKRVLHNILPTLRSLRALSFSQYKIKELPNDLFTKLKLLRFLDISRTWITKLPDSICGLYNLETLLLSSCADLEELPLQMEKLINLRHLDVSNTRRLKMPLHLSRLKSLQVLVGPKFFVDGWRMEDLGEAQNLHGSLSVVKLENVVDRREAVKAKMREKNHVEQLSLEWSESSIADNSQTESDILDELCPHKNIKKVEISGYRGTNFPNWVADPLFLKLVNLSLRNCKDCYSLPALGQLPCLKFLSVKGMHGIRVVTEEFYGRLSSKKPFNSLEKLEFEDMTEWKQWHALGIGEFPTLENLSIKNCPELSLEIPIQFSSLKRLEVSDCPVVFDDAQLFRSQLEAMKQIEEIDICDCNSVTSFPFSILPTTLKRIQISRCPKLKLEAPVGEMFVEYLRVNDCGCVDDISPEFLPTARQLSIENCQNVTRFLIPTATETLRISNCENVEKLSVACGGAAQMTSLNIWGCKKLKCLPELLPSLKELRLSDCPEIEGELPFNLEILRIIYCKKLVNGRKEWHLQRLTELWIDHDGSDEDIEHWELPCSIQRLTIKNLKTLSSQHLKSLTSLQYLCIEGYLSQIQSQGQLSSFSHLTSLQTLQIWNFLNLQSLAESALPSSLSHLEIDDCPNLQSLFESALPSSLSQLFIQDCPNLQSLPFKGMPSSLSKLSIFNCPLLTPLLEFDKGEYWPQIAHIPIINIDWKYI

disease resistance protein I2 disease resistance protein I2 [Solanum lycopersicum].

MEIGLAVGGAFLSSALNVLFDRLAPNGDLLNMFRKHKDHVKLLKKLKMTLRGIQIVLSDAENKQASNPSVRDWLNELRDAVDSAENLIEEVNYEALRLKVEGQHQNFSETSNQQVSDDFFLNIKDKLEDTIETLKDLQEQIGLLGLKEYFDSTKLETRRPSTSVDDESDIFGRQSEIEDLIDRLLSEGASGKKLTVVPIVGMGGQGKTTLAKAVYNDERVKNHFDLKAWYCVSEGFDALRITKELLQEIGKFDSKDVHNNLNQLQVKLKESLKGKKFLIVLDDVWNENYNEWNDLRNIFAQGDIGSKIIVTTRKDSVALMMGNEQIRMGNLSTEASWSLFQRHAFENMDPMGHPELEEVGRQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRKEQVIHLWIANGLVPVKDEINQDLGNQYFLELRSRSLFEKVPNPSKRNIEELFLMHDLVNDLAQLASSKLCIRLEESQGSHMLEQCRHLSYSIGFNGEFKKLTPLYKLEQLRTLLPIRIEFRLHNLSKRVLHNILPTLRSLRALSFSQYKIKELPNDLFTKLKLLRFLDISRTWITKLPDSICGLYNLETLLLSSCADLEELPLQMEKLINLRHLDVSNTRRLKMPLHLSRLKSLQVLVGPKFFVDGWRMEDLGEAQNLHGSLSVVKLENVVDRREAVKAKMREKNHVEQLSLEWSESSIADNSQTESDILDELCPHKNIKKVEISGYRGTNFPNWVADPLFLKLVNLSLRNCKDCYSLPALGQLPCLKFLSVKGMHGIRVVTEEFYGRLSSKKPFNSLEKLEFEDMTEWKQWHALGIGEFPTLENLSIKNCPELSLEIPIQFSSLKRLEVSDCPVVFDDAQLFRSQLEAMKQIEEIDICDCNSVTSFPFSILPTTLKRIQISRCPKLKLEAPVGEMFVEYLRVNDCGCVDDISPEFLPTARQLSIENCQNVTRFLIPTATETLRISNCENVEKLSVACGGAAQMTSLNIWGCKKLKCLPELLPSLKELRLSDCPEIEGELPFNLEILRIIYCKKLVNGRKEWHLQRLTELWIDHDGSDEDIEHWELPCSIQRLTIKNLKTLSSQHLKSLTSLQYLCIEGYLSQIQSQGQLSSFSHLTSLQTLQIWNFLNLQSLAESALPSSLSHLEIDDCPNLQSLFESALPSSLSQLFIQDCPNLQSLPFKGMPSSLSKLSIFNCPLLTPLLEFDKGEYWPQIAHIPIINIDWKYI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF236
11-1244 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

FLSSALNVLFDRLAPNGDLLNMFRKHKDHVKLLKKLKMTLRGIQIVLSDAENKQASNPSVRDWLNELRDAVDSAENLIEEVNYEALRLKVEGQHQNFSETSNQQVSDDFFLNIKDKLEDTIETLKDLQEQIGLLGLKEYFDSTKLETRRPSTSVDDESDIFGRQSEIEDLIDRLLSEGASGKKLTVVPIVGMGGQGKTTLAKAVYNDERVKNHFDLKAWYCVSEGFDALRITKELLQEIGKFDSKDVHNNLNQLQVKLKESLKGKKFLIVLDDVWNENYNEWNDLRNIFAQGDIGSKIIVTTRKDSVALMMGNEQIRMGNLSTEASWSLFQRHAFENMDPMGHPELEEVGRQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRKEQVIHLWIANGLVPVKDEINQDLGNQYFLELRSRSLFEKVPNPSKRNIEELFLMHDLVNDLAQLASSKLCIRLEESQGSHMLEQCRHLSYSIGFNGEFKKLTPLYKLEQLRTLLPIRIEFRLHNLSKRVLHNILPTLRSLRALSFSQYKIKELPNDLFTKLKLLRFLDISRTWITKLPDSICGLYNLETLLLSSCADLEELPLQMEKLINLRHLDVSNTRRLKMPLHLSRLKSLQVLVGPKFFVDGWRMEDLGEAQNLHGSLSVVKLENVVDRREAVKAKMREKNHVEQLSLEWSESSIADNSQTESDILDELCPHKNIKKVEISGYRGTNFPNWVADPLFLKLVNLSLRNCKDCYSLPALGQLPCLKFLSVKGMHGIRVVTEEFYGRLSSKKPFNSLEKLEFEDMTEWKQWHALGIGEFPTLENLSIKNCPELSLEIPIQFSSLKRLEVSDCPVVFDDAQLFRSQLEAMKQIEEIDICDCNSVTSFPFSILPTTLKRIQISRCPKLKLEAPVGEMFVEYLRVNDCGCVDDISPEFLPTARQLSIENCQNVTRFLIPTATETLRISNCENVEKLSVACGGAAQMTSLNIWGCKKLKCLPELLPSLKELRLSDCPEIEGELPFNLEILRIIYCKKLVNGRKEWHLQRLTELWIDHDGSDEDIEHWELPCSIQRLTIKNLKTLSSQHLKSLTSLQYLCIEGYLSQIQSQGQLSSFSHLTSLQTLQIWNFLNLQSLAESALPSSLSHLEIDDCPNLQSLFESALPSSLSQLFIQDCPNLQSLPFKGMPSSLSKLSIFNCPLLTPLLEF

HMMPanther: PTHR23155
11-1244 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FLSSALNVLFDRLAPNGDLLNMFRKHKDHVKLLKKLKMTLRGIQIVLSDAENKQASNPSVRDWLNELRDAVDSAENLIEEVNYEALRLKVEGQHQNFSETSNQQVSDDFFLNIKDKLEDTIETLKDLQEQIGLLGLKEYFDSTKLETRRPSTSVDDESDIFGRQSEIEDLIDRLLSEGASGKKLTVVPIVGMGGQGKTTLAKAVYNDERVKNHFDLKAWYCVSEGFDALRITKELLQEIGKFDSKDVHNNLNQLQVKLKESLKGKKFLIVLDDVWNENYNEWNDLRNIFAQGDIGSKIIVTTRKDSVALMMGNEQIRMGNLSTEASWSLFQRHAFENMDPMGHPELEEVGRQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRKEQVIHLWIANGLVPVKDEINQDLGNQYFLELRSRSLFEKVPNPSKRNIEELFLMHDLVNDLAQLASSKLCIRLEESQGSHMLEQCRHLSYSIGFNGEFKKLTPLYKLEQLRTLLPIRIEFRLHNLSKRVLHNILPTLRSLRALSFSQYKIKELPNDLFTKLKLLRFLDISRTWITKLPDSICGLYNLETLLLSSCADLEELPLQMEKLINLRHLDVSNTRRLKMPLHLSRLKSLQVLVGPKFFVDGWRMEDLGEAQNLHGSLSVVKLENVVDRREAVKAKMREKNHVEQLSLEWSESSIADNSQTESDILDELCPHKNIKKVEISGYRGTNFPNWVADPLFLKLVNLSLRNCKDCYSLPALGQLPCLKFLSVKGMHGIRVVTEEFYGRLSSKKPFNSLEKLEFEDMTEWKQWHALGIGEFPTLENLSIKNCPELSLEIPIQFSSLKRLEVSDCPVVFDDAQLFRSQLEAMKQIEEIDICDCNSVTSFPFSILPTTLKRIQISRCPKLKLEAPVGEMFVEYLRVNDCGCVDDISPEFLPTARQLSIENCQNVTRFLIPTATETLRISNCENVEKLSVACGGAAQMTSLNIWGCKKLKCLPELLPSLKELRLSDCPEIEGELPFNLEILRIIYCKKLVNGRKEWHLQRLTELWIDHDGSDEDIEHWELPCSIQRLTIKNLKTLSSQHLKSLTSLQYLCIEGYLSQIQSQGQLSSFSHLTSLQTLQIWNFLNLQSLAESALPSSLSHLEIDDCPNLQSLFESALPSSLSQLFIQDCPNLQSLPFKGMPSSLSKLSIFNCPLLTPLLEF

HMMPanther: PTHR23155:SF236
11-1244 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

FLSSALNVLFDRLAPNGDLLNMFRKHKDHVKLLKKLKMTLRGIQIVLSDAENKQASNPSVRDWLNELRDAVDSAENLIEEVNYEALRLKVEGQHQNFSETSNQQVSDDFFLNIKDKLEDTIETLKDLQEQIGLLGLKEYFDSTKLETRRPSTSVDDESDIFGRQSEIEDLIDRLLSEGASGKKLTVVPIVGMGGQGKTTLAKAVYNDERVKNHFDLKAWYCVSEGFDALRITKELLQEIGKFDSKDVHNNLNQLQVKLKESLKGKKFLIVLDDVWNENYNEWNDLRNIFAQGDIGSKIIVTTRKDSVALMMGNEQIRMGNLSTEASWSLFQRHAFENMDPMGHPELEEVGRQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRKEQVIHLWIANGLVPVKDEINQDLGNQYFLELRSRSLFEKVPNPSKRNIEELFLMHDLVNDLAQLASSKLCIRLEESQGSHMLEQCRHLSYSIGFNGEFKKLTPLYKLEQLRTLLPIRIEFRLHNLSKRVLHNILPTLRSLRALSFSQYKIKELPNDLFTKLKLLRFLDISRTWITKLPDSICGLYNLETLLLSSCADLEELPLQMEKLINLRHLDVSNTRRLKMPLHLSRLKSLQVLVGPKFFVDGWRMEDLGEAQNLHGSLSVVKLENVVDRREAVKAKMREKNHVEQLSLEWSESSIADNSQTESDILDELCPHKNIKKVEISGYRGTNFPNWVADPLFLKLVNLSLRNCKDCYSLPALGQLPCLKFLSVKGMHGIRVVTEEFYGRLSSKKPFNSLEKLEFEDMTEWKQWHALGIGEFPTLENLSIKNCPELSLEIPIQFSSLKRLEVSDCPVVFDDAQLFRSQLEAMKQIEEIDICDCNSVTSFPFSILPTTLKRIQISRCPKLKLEAPVGEMFVEYLRVNDCGCVDDISPEFLPTARQLSIENCQNVTRFLIPTATETLRISNCENVEKLSVACGGAAQMTSLNIWGCKKLKCLPELLPSLKELRLSDCPEIEGELPFNLEILRIIYCKKLVNGRKEWHLQRLTELWIDHDGSDEDIEHWELPCSIQRLTIKNLKTLSSQHLKSLTSLQYLCIEGYLSQIQSQGQLSSFSHLTSLQTLQIWNFLNLQSLAESALPSSLSHLEIDDCPNLQSLFESALPSSLSQLFIQDCPNLQSLPFKGMPSSLSKLSIFNCPLLTPLLEF

HMMPanther: PTHR23155
11-1244 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FLSSALNVLFDRLAPNGDLLNMFRKHKDHVKLLKKLKMTLRGIQIVLSDAENKQASNPSVRDWLNELRDAVDSAENLIEEVNYEALRLKVEGQHQNFSETSNQQVSDDFFLNIKDKLEDTIETLKDLQEQIGLLGLKEYFDSTKLETRRPSTSVDDESDIFGRQSEIEDLIDRLLSEGASGKKLTVVPIVGMGGQGKTTLAKAVYNDERVKNHFDLKAWYCVSEGFDALRITKELLQEIGKFDSKDVHNNLNQLQVKLKESLKGKKFLIVLDDVWNENYNEWNDLRNIFAQGDIGSKIIVTTRKDSVALMMGNEQIRMGNLSTEASWSLFQRHAFENMDPMGHPELEEVGRQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRKEQVIHLWIANGLVPVKDEINQDLGNQYFLELRSRSLFEKVPNPSKRNIEELFLMHDLVNDLAQLASSKLCIRLEESQGSHMLEQCRHLSYSIGFNGEFKKLTPLYKLEQLRTLLPIRIEFRLHNLSKRVLHNILPTLRSLRALSFSQYKIKELPNDLFTKLKLLRFLDISRTWITKLPDSICGLYNLETLLLSSCADLEELPLQMEKLINLRHLDVSNTRRLKMPLHLSRLKSLQVLVGPKFFVDGWRMEDLGEAQNLHGSLSVVKLENVVDRREAVKAKMREKNHVEQLSLEWSESSIADNSQTESDILDELCPHKNIKKVEISGYRGTNFPNWVADPLFLKLVNLSLRNCKDCYSLPALGQLPCLKFLSVKGMHGIRVVTEEFYGRLSSKKPFNSLEKLEFEDMTEWKQWHALGIGEFPTLENLSIKNCPELSLEIPIQFSSLKRLEVSDCPVVFDDAQLFRSQLEAMKQIEEIDICDCNSVTSFPFSILPTTLKRIQISRCPKLKLEAPVGEMFVEYLRVNDCGCVDDISPEFLPTARQLSIENCQNVTRFLIPTATETLRISNCENVEKLSVACGGAAQMTSLNIWGCKKLKCLPELLPSLKELRLSDCPEIEGELPFNLEILRIIYCKKLVNGRKEWHLQRLTELWIDHDGSDEDIEHWELPCSIQRLTIKNLKTLSSQHLKSLTSLQYLCIEGYLSQIQSQGQLSSFSHLTSLQTLQIWNFLNLQSLAESALPSSLSHLEIDDCPNLQSLFESALPSSLSQLFIQDCPNLQSLPFKGMPSSLSKLSIFNCPLLTPLLEF

superfamily: SSF52540
153-404 SSF52540

TKLETRRPSTSVDDESDIFGRQSEIEDLIDRLLSEGASGKKLTVVPIVGMGGQGKTTLAKAVYNDERVKNHFDLKAWYCVSEGFDALRITKELLQEIGKFDSKDVHNNLNQLQVKLKESLKGKKFLIVLDDVWNENYNEWNDLRNIFAQGDIGSKIIVTTRKDSVALMMGNEQIRMGNLSTEASWSLFQRHAFENMDPMGHPELEEVGRQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHN

superfamily: SSF52540
153-404 SSF52540

TKLETRRPSTSVDDESDIFGRQSEIEDLIDRLLSEGASGKKLTVVPIVGMGGQGKTTLAKAVYNDERVKNHFDLKAWYCVSEGFDALRITKELLQEIGKFDSKDVHNNLNQLQVKLKESLKGKKFLIVLDDVWNENYNEWNDLRNIFAQGDIGSKIIVTTRKDSVALMMGNEQIRMGNLSTEASWSLFQRHAFENMDPMGHPELEEVGRQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHN

Gene3D: G3DSA:3.40.50.300
167-311 G3DSA:3.40.50.300

ESDIFGRQSEIEDLIDRLLSEGASGKKLTVVPIVGMGGQGKTTLAKAVYNDERVKNHFDLKAWYCVSEGFDALRITKELLQEIGKFDSKDVHNNLNQLQVKLKESLKGKKFLIVLDDVWNENYNEWNDLRNIFAQGDIGSKIIVT

Gene3D: G3DSA:3.40.50.300
167-311 G3DSA:3.40.50.300

ESDIFGRQSEIEDLIDRLLSEGASGKKLTVVPIVGMGGQGKTTLAKAVYNDERVKNHFDLKAWYCVSEGFDALRITKELLQEIGKFDSKDVHNNLNQLQVKLKESLKGKKFLIVLDDVWNENYNEWNDLRNIFAQGDIGSKIIVT

HMMPfam: PF00931
IPR002182
173-456 NB-ARC,NBS
NB-ARC

RQSEIEDLIDRLLSEGASGKKLTVVPIVGMGGQGKTTLAKAVYNDERVKNHFDLKAWYCVSEGFDALRITKELLQEIGKFDSKDVHNNLNQLQVKLKESLKGKKFLIVLDDVWNENYNEWNDLRNIFAQGDIGSKIIVTTRKDSVALMMGNEQIRMGNLSTEASWSLFQRHAFENMDPMGHPELEEVGRQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRKEQVIHLWIANGLVPVKD

HMMPfam: PF00931
IPR002182
173-456 NB-ARC,NBS
NB-ARC

RQSEIEDLIDRLLSEGASGKKLTVVPIVGMGGQGKTTLAKAVYNDERVKNHFDLKAWYCVSEGFDALRITKELLQEIGKFDSKDVHNNLNQLQVKLKESLKGKKFLIVLDDVWNENYNEWNDLRNIFAQGDIGSKIIVTTRKDSVALMMGNEQIRMGNLSTEASWSLFQRHAFENMDPMGHPELEEVGRQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRKEQVIHLWIANGLVPVKD

FPrintScan: PR00364
IPR000767
196-211 DISEASERSIST
Disease resistance protein

VVPIVGMGGQGKTTLA

FPrintScan: PR00364
IPR000767
196-211 DISEASERSIST
Disease resistance protein

VVPIVGMGGQGKTTLA

FPrintScan: PR00364
IPR000767
271-285 DISEASERSIST
Disease resistance protein

SLKGKKFLIVLDDVW

FPrintScan: PR00364
IPR000767
271-285 DISEASERSIST
Disease resistance protein

SLKGKKFLIVLDDVW

FPrintScan: PR00364
IPR000767
367-381 DISEASERSIST
Disease resistance protein

CKGLPLALKTLAGML

FPrintScan: PR00364
IPR000767
367-381 DISEASERSIST
Disease resistance protein

CKGLPLALKTLAGML

Gene3D: G3DSA:3.80.10.10
455-676 G3DSA:3.80.10.10

KDEINQDLGNQYFLELRSRSLFEKVPNPSKRNIEELFLMHDLVNDLAQLASSKLCIRLEESQGSHMLEQCRHLSYSIGFNGEFKKLTPLYKLEQLRTLLPIRIEFRLHNLSKRVLHNILPTLRSLRALSFSQYKIKELPNDLFTKLKLLRFLDISRTWITKLPDSICGLYNLETLLLSSCADLEELPLQMEKLINLRHLDVSNTRRLKMPLHLSRLKSLQVL

Gene3D: G3DSA:3.80.10.10
455-676 G3DSA:3.80.10.10

KDEINQDLGNQYFLELRSRSLFEKVPNPSKRNIEELFLMHDLVNDLAQLASSKLCIRLEESQGSHMLEQCRHLSYSIGFNGEFKKLTPLYKLEQLRTLLPIRIEFRLHNLSKRVLHNILPTLRSLRALSFSQYKIKELPNDLFTKLKLLRFLDISRTWITKLPDSICGLYNLETLLLSSCADLEELPLQMEKLINLRHLDVSNTRRLKMPLHLSRLKSLQVL

superfamily: SSF52058
492-988 SSF52058,LRR

LMHDLVNDLAQLASSKLCIRLEESQGSHMLEQCRHLSYSIGFNGEFKKLTPLYKLEQLRTLLPIRIEFRLHNLSKRVLHNILPTLRSLRALSFSQYKIKELPNDLFTKLKLLRFLDISRTWITKLPDSICGLYNLETLLLSSCADLEELPLQMEKLINLRHLDVSNTRRLKMPLHLSRLKSLQVLVGPKFFVDGWRMEDLGEAQNLHGSLSVVKLENVVDRREAVKAKMREKNHVEQLSLEWSESSIADNSQTESDILDELCPHKNIKKVEISGYRGTNFPNWVADPLFLKLVNLSLRNCKDCYSLPALGQLPCLKFLSVKGMHGIRVVTEEFYGRLSSKKPFNSLEKLEFEDMTEWKQWHALGIGEFPTLENLSIKNCPELSLEIPIQFSSLKRLEVSDCPVVFDDAQLFRSQLEAMKQIEEIDICDCNSVTSFPFSILPTTLKRIQISRCPKLKLEAPVGEMFVEYLRVNDCGCVDDISPEFLPTARQLSIENCQ

superfamily: SSF52058
492-988 SSF52058,LRR

LMHDLVNDLAQLASSKLCIRLEESQGSHMLEQCRHLSYSIGFNGEFKKLTPLYKLEQLRTLLPIRIEFRLHNLSKRVLHNILPTLRSLRALSFSQYKIKELPNDLFTKLKLLRFLDISRTWITKLPDSICGLYNLETLLLSSCADLEELPLQMEKLINLRHLDVSNTRRLKMPLHLSRLKSLQVLVGPKFFVDGWRMEDLGEAQNLHGSLSVVKLENVVDRREAVKAKMREKNHVEQLSLEWSESSIADNSQTESDILDELCPHKNIKKVEISGYRGTNFPNWVADPLFLKLVNLSLRNCKDCYSLPALGQLPCLKFLSVKGMHGIRVVTEEFYGRLSSKKPFNSLEKLEFEDMTEWKQWHALGIGEFPTLENLSIKNCPELSLEIPIQFSSLKRLEVSDCPVVFDDAQLFRSQLEAMKQIEEIDICDCNSVTSFPFSILPTTLKRIQISRCPKLKLEAPVGEMFVEYLRVNDCGCVDDISPEFLPTARQLSIENCQ

FPrintScan: PR00364
IPR000767
645-661 DISEASERSIST
Disease resistance protein

EKLINLRHLDVSNTRRL

FPrintScan: PR00364
IPR000767
645-661 DISEASERSIST
Disease resistance protein

EKLINLRHLDVSNTRRL

Gene3D: G3DSA:3.80.10.10
741-938 G3DSA:3.80.10.10

NSQTESDILDELCPHKNIKKVEISGYRGTNFPNWVADPLFLKLVNLSLRNCKDCYSLPALGQLPCLKFLSVKGMHGIRVVTEEFYGRLSSKKPFNSLEKLEFEDMTEWKQWHALGIGEFPTLENLSIKNCPELSLEIPIQFSSLKRLEVSDCPVVFDDAQLFRSQLEAMKQIEEIDICDCNSVTSFPFSILPTTLKRI

Gene3D: G3DSA:3.80.10.10
741-938 G3DSA:3.80.10.10

NSQTESDILDELCPHKNIKKVEISGYRGTNFPNWVADPLFLKLVNLSLRNCKDCYSLPALGQLPCLKFLSVKGMHGIRVVTEEFYGRLSSKKPFNSLEKLEFEDMTEWKQWHALGIGEFPTLENLSIKNCPELSLEIPIQFSSLKRLEVSDCPVVFDDAQLFRSQLEAMKQIEEIDICDCNSVTSFPFSILPTTLKRI

Gene3D: G3DSA:3.80.10.10
939-1099 G3DSA:3.80.10.10

QISRCPKLKLEAPVGEMFVEYLRVNDCGCVDDISPEFLPTARQLSIENCQNVTRFLIPTATETLRISNCENVEKLSVACGGAAQMTSLNIWGCKKLKCLPELLPSLKELRLSDCPEIEGELPFNLEILRIIYCKKLVNGRKEWHLQRLTELWIDHDGSDED

Gene3D: G3DSA:3.80.10.10
939-1099 G3DSA:3.80.10.10

QISRCPKLKLEAPVGEMFVEYLRVNDCGCVDDISPEFLPTARQLSIENCQNVTRFLIPTATETLRISNCENVEKLSVACGGAAQMTSLNIWGCKKLKCLPELLPSLKELRLSDCPEIEGELPFNLEILRIIYCKKLVNGRKEWHLQRLTELWIDHDGSDED

superfamily: SSF52058
1000-1255 SSF52058,LRR

ETLRISNCENVEKLSVACGGAAQMTSLNIWGCKKLKCLPELLPSLKELRLSDCPEIEGELPFNLEILRIIYCKKLVNGRKEWHLQRLTELWIDHDGSDEDIEHWELPCSIQRLTIKNLKTLSSQHLKSLTSLQYLCIEGYLSQIQSQGQLSSFSHLTSLQTLQIWNFLNLQSLAESALPSSLSHLEIDDCPNLQSLFESALPSSLSQLFIQDCPNLQSLPFKGMPSSLSKLSIFNCPLLTPLLEFDKGEYWPQIAH

superfamily: SSF52058
1000-1255 SSF52058,LRR

ETLRISNCENVEKLSVACGGAAQMTSLNIWGCKKLKCLPELLPSLKELRLSDCPEIEGELPFNLEILRIIYCKKLVNGRKEWHLQRLTELWIDHDGSDEDIEHWELPCSIQRLTIKNLKTLSSQHLKSLTSLQYLCIEGYLSQIQSQGQLSSFSHLTSLQTLQIWNFLNLQSLAESALPSSLSHLEIDDCPNLQSLFESALPSSLSQLFIQDCPNLQSLPFKGMPSSLSKLSIFNCPLLTPLLEFDKGEYWPQIAH

Gene3D: G3DSA:3.80.10.10
1100-1237 G3DSA:3.80.10.10

IEHWELPCSIQRLTIKNLKTLSSQHLKSLTSLQYLCIEGYLSQIQSQGQLSSFSHLTSLQTLQIWNFLNLQSLAESALPSSLSHLEIDDCPNLQSLFESALPSSLSQLFIQDCPNLQSLPFKGMPSSLSKLSIFNCPL

Gene3D: G3DSA:3.80.10.10
1100-1237 G3DSA:3.80.10.10

IEHWELPCSIQRLTIKNLKTLSSQHLKSLTSLQYLCIEGYLSQIQSQGQLSSFSHLTSLQTLQIWNFLNLQSLAESALPSSLSHLEIDDCPNLQSLFESALPSSLSQLFIQDCPNLQSLPFKGMPSSLSKLSIFNCPL


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox