PRGDB00062192 (putative disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 225001246 (FJ654703)
Gene Class Unknown
Domain Type LRR
Gene Species Arachis hypogaea

Comment?

Arachis hypogaea clone fosmid 946, partial sequence.

DNA Sequence

ATGCAAAGCATCATTTATCTTTGCGTAACAATCATCTTGTGCATTCACACAAACAATAAGTGTGGTTTCCTCGTACAAGGTCTCACCTCATCCTCAGACATTGAAGCACTAAAGGCTTTCAAGGCCTCAATCAAATCCTCCTCAATAACACCATGGTCATGCATAGCATCCTGGAACTTCACCACTGACCCATGCTCCGTCCCTCGCCGCACCCACTTCACGTGCGGCCTCACCTGCACCGCCGACAACACCCGCATCAACCAAATCACCCTCGACCCCGCTGGCTACACAGGAACACTCACCCCACTCGTCTCTCAACTCACCACACTCATCACTCTCGACCTCTCCGATAACTCTTTCTATGGCACAATCCCTTCTTCTCTATCTTCCCTCTCAAAACTCCAAACTTTATCCCTCCGATCCAACTCTTTCTCAGGTTCAATCCCTCCCTCCATAGCCACCCTCAAATCGCTCCAATCGCTTGATCTTTCACAGAATTCTCTTTCTGGGTTCCTTCCAAAGTCCATGAACTCTCTCACTAGTCTCCGAAGATTGGACCTCAGCTTCAACAAGCTCACCGGTGGACTCCCCAAGTTACCACCCAACTTGCTGGATTTGGCGATCAAGGCAAATTCTCTATCTGGGGTTCTTCAAAAAACAACCTTTGAAGGTTTGAACCAGTTGGAAGTGGTGGAACTCAGTGATAACGCACTTCAGGGGATCATCGAAACGTGGCTCTTCCTTTTGCCTTCCCTGCAGCAACTGGATTTGGCCAACAACTCCTTCAGTGGTGTTGAGATCTCGAGGCCGGTTGTTGGCGGTGGCGGGAACAGCCTCGTGGCGGTGAATCTTGGATTCAACAAGATCCAAGGCTACGCCCCCGCGAATCTCGGCGCGTATCCGTCGCTGTCATTTTTGTCGCTCCGTTACAACGCGCTACGTGGCGCGATACCATTGGAATACGGGAAAAGCAAGTCCATGAAGAGGTTGTTCCTGGACGGGAACTTCCTAATGGGGAGGCCACCGGCGGGACTGGTGGCTGCCGGAGCTGAAGTTTCCGGCAGCTTGGGTGACAACTGCCTTGAGGGGTGTCCGGCGATGTCGCAGCTGTGCACGCCGAAACAGAAACCGAGCTCTGTTTGCAAGCAAGTCTACCGTGGAAGACCTACGAGATAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arachis hypogaea].

MQSIIYLCVTIILCIHTNNKCGFLVQGLTSSSDIEALKAFKASIKSSSITPWSCIASWNFTTDPCSVPRRTHFTCGLTCTADNTRINQITLDPAGYTGTLTPLVSQLTTLITLDLSDNSFYGTIPSSLSSLSKLQTLSLRSNSFSGSIPPSIATLKSLQSLDLSQNSLSGFLPKSMNSLTSLRRLDLSFNKLTGGLPKLPPNLLDLAIKANSLSGVLQKTTFEGLNQLEVVELSDNALQGIIETWLFLLPSLQQLDLANNSFSGVEISRPVVGGGGNSLVAVNLGFNKIQGYAPANLGAYPSLSFLSLRYNALRGAIPLEYGKSKSMKRLFLDGNFLMGRPPAGLVAAGAEVSGSLGDNCLEGCPAMSQLCTPKQKPSSVCKQVYRGRPTR

putative disease resistance protein putative disease resistance protein [Arachis hypogaea].

MQSIIYLCVTIILCIHTNNKCGFLVQGLTSSSDIEALKAFKASIKSSSITPWSCIASWNFTTDPCSVPRRTHFTCGLTCTADNTRINQITLDPAGYTGTLTPLVSQLTTLITLDLSDNSFYGTIPSSLSSLSKLQTLSLRSNSFSGSIPPSIATLKSLQSLDLSQNSLSGFLPKSMNSLTSLRRLDLSFNKLTGGLPKLPPNLLDLAIKANSLSGVLQKTTFEGLNQLEVVELSDNALQGIIETWLFLLPSLQQLDLANNSFSGVEISRPVVGGGGNSLVAVNLGFNKIQGYAPANLGAYPSLSFLSLRYNALRGAIPLEYGKSKSMKRLFLDGNFLMGRPPAGLVAAGAEVSGSLGDNCLEGCPAMSQLCTPKQKPSSVCKQVYRGRPTR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
28-365 PTHR24420:SF473,SUBFAMILY NOT NAMED

LTSSSDIEALKAFKASIKSSSITPWSCIASWNFTTDPCSVPRRTHFTCGLTCTADNTRINQITLDPAGYTGTLTPLVSQLTTLITLDLSDNSFYGTIPSSLSSLSKLQTLSLRSNSFSGSIPPSIATLKSLQSLDLSQNSLSGFLPKSMNSLTSLRRLDLSFNKLTGGLPKLPPNLLDLAIKANSLSGVLQKTTFEGLNQLEVVELSDNALQGIIETWLFLLPSLQQLDLANNSFSGVEISRPVVGGGGNSLVAVNLGFNKIQGYAPANLGAYPSLSFLSLRYNALRGAIPLEYGKSKSMKRLFLDGNFLMGRPPAGLVAAGAEVSGSLGDNCLEGCP

HMMPanther: PTHR24420
28-365 PTHR24420,FAMILY NOT NAMED

LTSSSDIEALKAFKASIKSSSITPWSCIASWNFTTDPCSVPRRTHFTCGLTCTADNTRINQITLDPAGYTGTLTPLVSQLTTLITLDLSDNSFYGTIPSSLSSLSKLQTLSLRSNSFSGSIPPSIATLKSLQSLDLSQNSLSGFLPKSMNSLTSLRRLDLSFNKLTGGLPKLPPNLLDLAIKANSLSGVLQKTTFEGLNQLEVVELSDNALQGIIETWLFLLPSLQQLDLANNSFSGVEISRPVVGGGGNSLVAVNLGFNKIQGYAPANLGAYPSLSFLSLRYNALRGAIPLEYGKSKSMKRLFLDGNFLMGRPPAGLVAAGAEVSGSLGDNCLEGCP

HMMPanther: PTHR24420:SF473
28-365 PTHR24420:SF473,SUBFAMILY NOT NAMED

LTSSSDIEALKAFKASIKSSSITPWSCIASWNFTTDPCSVPRRTHFTCGLTCTADNTRINQITLDPAGYTGTLTPLVSQLTTLITLDLSDNSFYGTIPSSLSSLSKLQTLSLRSNSFSGSIPPSIATLKSLQSLDLSQNSLSGFLPKSMNSLTSLRRLDLSFNKLTGGLPKLPPNLLDLAIKANSLSGVLQKTTFEGLNQLEVVELSDNALQGIIETWLFLLPSLQQLDLANNSFSGVEISRPVVGGGGNSLVAVNLGFNKIQGYAPANLGAYPSLSFLSLRYNALRGAIPLEYGKSKSMKRLFLDGNFLMGRPPAGLVAAGAEVSGSLGDNCLEGCP

HMMPanther: PTHR24420
28-365 PTHR24420,FAMILY NOT NAMED

LTSSSDIEALKAFKASIKSSSITPWSCIASWNFTTDPCSVPRRTHFTCGLTCTADNTRINQITLDPAGYTGTLTPLVSQLTTLITLDLSDNSFYGTIPSSLSSLSKLQTLSLRSNSFSGSIPPSIATLKSLQSLDLSQNSLSGFLPKSMNSLTSLRRLDLSFNKLTGGLPKLPPNLLDLAIKANSLSGVLQKTTFEGLNQLEVVELSDNALQGIIETWLFLLPSLQQLDLANNSFSGVEISRPVVGGGGNSLVAVNLGFNKIQGYAPANLGAYPSLSFLSLRYNALRGAIPLEYGKSKSMKRLFLDGNFLMGRPPAGLVAAGAEVSGSLGDNCLEGCP

HMMPfam: PF08263
IPR013210
31-66 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

SSDIEALKAFKASIKSSSITPWSCIASWNFTTDPCS

HMMPfam: PF08263
IPR013210
31-66 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

SSDIEALKAFKASIKSSSITPWSCIASWNFTTDPCS

superfamily: SSF52058
73-371 SSF52058,LRR

FTCGLTCTADNTRINQITLDPAGYTGTLTPLVSQLTTLITLDLSDNSFYGTIPSSLSSLSKLQTLSLRSNSFSGSIPPSIATLKSLQSLDLSQNSLSGFLPKSMNSLTSLRRLDLSFNKLTGGLPKLPPNLLDLAIKANSLSGVLQKTTFEGLNQLEVVELSDNALQGIIETWLFLLPSLQQLDLANNSFSGVEISRPVVGGGGNSLVAVNLGFNKIQGYAPANLGAYPSLSFLSLRYNALRGAIPLEYGKSKSMKRLFLDGNFLMGRPPAGLVAAGAEVSGSLGDNCLEGCPAMSQLC

superfamily: SSF52058
73-371 SSF52058,LRR

FTCGLTCTADNTRINQITLDPAGYTGTLTPLVSQLTTLITLDLSDNSFYGTIPSSLSSLSKLQTLSLRSNSFSGSIPPSIATLKSLQSLDLSQNSLSGFLPKSMNSLTSLRRLDLSFNKLTGGLPKLPPNLLDLAIKANSLSGVLQKTTFEGLNQLEVVELSDNALQGIIETWLFLLPSLQQLDLANNSFSGVEISRPVVGGGGNSLVAVNLGFNKIQGYAPANLGAYPSLSFLSLRYNALRGAIPLEYGKSKSMKRLFLDGNFLMGRPPAGLVAAGAEVSGSLGDNCLEGCPAMSQLC

Gene3D: G3DSA:3.80.10.10
75-265 G3DSA:3.80.10.10

CGLTCTADNTRINQITLDPAGYTGTLTPLVSQLTTLITLDLSDNSFYGTIPSSLSSLSKLQTLSLRSNSFSGSIPPSIATLKSLQSLDLSQNSLSGFLPKSMNSLTSLRRLDLSFNKLTGGLPKLPPNLLDLAIKANSLSGVLQKTTFEGLNQLEVVELSDNALQGIIETWLFLLPSLQQLDLANNSFSGV

Gene3D: G3DSA:3.80.10.10
75-265 G3DSA:3.80.10.10

CGLTCTADNTRINQITLDPAGYTGTLTPLVSQLTTLITLDLSDNSFYGTIPSSLSSLSKLQTLSLRSNSFSGSIPPSIATLKSLQSLDLSQNSLSGFLPKSMNSLTSLRRLDLSFNKLTGGLPKLPPNLLDLAIKANSLSGVLQKTTFEGLNQLEVVELSDNALQGIIETWLFLLPSLQQLDLANNSFSGV

HMMPfam: PF13855
109-168 LRR_8,Leucine rich repeat

TLITLDLSDNSFYGTIPSSLSSLSKLQTLSLRSNSFSGSIPPSIATLKSLQSLDLSQNSL

HMMPfam: PF13855
109-168 LRR_8,Leucine rich repeat

TLITLDLSDNSFYGTIPSSLSSLSKLQTLSLRSNSFSGSIPPSIATLKSLQSLDLSQNSL

FPrintScan: PR00019
158-171 LEURICHRPT,Leucine-rich repeat signature

LQSLDLSQNSLSGF

FPrintScan: PR00019
158-171 LEURICHRPT,Leucine-rich repeat signature

LQSLDLSQNSLSGF

FPrintScan: PR00019
179-192 LEURICHRPT,Leucine-rich repeat signature

LTSLRRLDLSFNKL

FPrintScan: PR00019
179-192 LEURICHRPT,Leucine-rich repeat signature

LTSLRRLDLSFNKL

HMMPfam: PF13504
180-197 LRR_7,Leucine rich repeat

TSLRRLDLSFNKLTGGLP

HMMPfam: PF13504
180-197 LRR_7,Leucine rich repeat

TSLRRLDLSFNKLTGGLP

HMMPfam: PF13855
201-261 LRR_8,Leucine rich repeat

PNLLDLAIKANSLSGVLQKTTFEGLNQLEVVELSDNALQGIIETWLFLLPSLQQLDLANNS

HMMPfam: PF13855
201-261 LRR_8,Leucine rich repeat

PNLLDLAIKANSLSGVLQKTTFEGLNQLEVVELSDNALQGIIETWLFLLPSLQQLDLANNS

Gene3D: G3DSA:3.80.10.10
277-343 G3DSA:3.80.10.10

NSLVAVNLGFNKIQGYAPANLGAYPSLSFLSLRYNALRGAIPLEYGKSKSMKRLFLDGNFLMGRPPA

Gene3D: G3DSA:3.80.10.10
277-343 G3DSA:3.80.10.10

NSLVAVNLGFNKIQGYAPANLGAYPSLSFLSLRYNALRGAIPLEYGKSKSMKRLFLDGNFLMGRPPA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox