PRGDB00062193 (putative disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 13272422 (AF325082)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana putative disease resistance protein (At2g34930) mRNA, complete cds.

DNA Sequence

ATGGACCTCAAGCTAAGGCCTAGCTTCTTCATCTCTTTTCTGATTCTCATTTTACTTCTCAAAAATCTTAATTACGGATCTGCAGCTAGTCCGAAATGCATATCCACCGAGCGGCAAGCTCTTCTCACCTTCAGAGCAGCACTAACTGATCTTTCGAGTAGGCTCTTTTCTTGGTCCGGACCTGACTGCTGCAACTGGCCCGGTGTTCTTTGCGATGCTCGGACCAGCCACGTTGTCAAGATTGATCTCAGAAACCCGAGTCAAGATGTTCGCTCTGATGAGTATAAAAGAGGTTCCTTGCGAGGGAAGATACATCCGTCTTTGACTCAACTCAAGTTCTTGAGCTATCTGGACTTGAGTTCAAATGATTTCAATGAACTAGAGATTCCTGAGTTTATTGGCCAAATTGTTAGTCTAAGGTACCTGAATCTTTCTTCCTCATCGTTTTCCGGCGAAATCCCAACGAGTCTTGGAAATTTGTCGAAGCTGGAGTCTCTTGATCTGTATGCAGAGTCGTTTGGTGACTCTGGTACATTATCATTGCGCGCAAGCAATCTCCGGTGGCTTTCAAGTCTGTCTTCTTCCCTGAAGTATCTCAACATGGGGTATGTAAATCTAAGTGGTGCGGGTGAAACCTGGTTACAGGATTTCAGCAGAATCTCGGCGCTAAAGGAGTTGCATTTGTTCAATAGTGAGCTCAAGAACTTACCTCCCACCTTGTCTTCGTCTGCGGATCTGAAGCTCCTTGAAGTTCTTGATTTGTCTGAAAACTCTCTCAATTCGCCGATACCTAACTGGCTATTTGGTCTTACCAACCTCAGAAAGCTATTCCTCAGATGGGATTTTCTCCAGGGTTCGATTCCTACGGGGTTCAAGAACTTGAAGCTTCTAGAGACACTTGATCTGTCGAATAATCTGGCACTACAAGGCGAGATTCCATCGGTTCTTGGAGACCTTCCTCAACTGAAGTTTCTTGACCTTTCTGCAAACGAACTCAACGGTCAAATCCATGGGTTTCTAGACGCCTTCTCCAGAAACAAAGGAAACAGCTTGGTCTTTCTCGATCTCAGTTCCAACAAGTTAGCTGGGACATTGCCCGAGTCACTTGGATCGTTGAGGAATCTGCAGACTCTGGATCTTTCATCGAATTCCTTCACGGGTTCGGTCCCTTCCTCGATAGGAAACATGGCGTCACTGAAGAAACTTGATCTTTCTAACAATGCCATGAACGGGACAATTGCGGAAAGCTTGGGGCAGCTTGCAGAGCTTGTGGATCTGAACTTGATGGCGAATACATGGGGAGGCGTTCTGCAAAAGTCACATTTCGTGAATCTCAGAAGCTTGAAAAGCATCCGTCTAACAACTGAACCATACAGATCTCTTGTCTTCAAGTTACCATCTACTTGGATTCCTCCTTTCAGACTGGAGTTGATCCAAATCGAGAACTGTCGGATCGGTCTGTTTCCAATGTGGCTCCAAGTACAAACCAAGCTCAACTTTGTCACACTCAGAAACACTGGTATTGAAGATACAATACCGGATAGCTGGTTCTCTGGAATCTCTTCTAAAGTTACTTACCTAATTCTAGCAAACAACAGAATCAAAGGTAGATTACCTCAAAAGCTTGCGTTCCCAAAGTTAAACACCATTGATTTGAGCTCCAACAACTTTGAAGGCACTTTTCCTCTCTGGTCTACAAACGCAACAGAGCTGCGTCTTTACGAGAACAACTTCTCGGGTTCTCTTCCACAAAACATTGACGTCTTGATGCCAAGAATGGAGAAGATCTACCTCTTTAGCAACAGCTTCACAGGCAACATCCCATCGTCTCTATGTGAAGTCTCCGGACTGCAAATTCTGTCACTGAGGAAGAACCATTTCTCTGGTAGTTTTCCAAAATGTTGGCACCGTCAGTTCATGCTTTGGGGAATTGACGTGTCTGAGAATAACTTATCAGGCGAAATACCAGAGTCTCTTGGTATGTTACCTTCTCTCAGCGTCTTGCTTCTGAACCAAAATTCGTTGGAAGGTAAAATCCCAGAGAGTCTTCGGAATTGTTCTGGCCTTACGAACATAGATCTCGGAGGAAACAAGCTGACCGGGAAGCTTCCTTCATGGGTAGGAAAGCTGTCTTCTCTATTCATGCTTCGTCTGCAAAGTAACTCCTTCACTGGTCAAATCCCAGATGATCTCTGCAACGTTCCAAATCTACGCATTCTGGACCTCTCCGGAAACAAAATCTCGGGCCCTATTCCAAAATGCATCAGCAATCTCACAGCCATTGCTCGAGGTACAAACAATGAGGTGTTCCAGAATCTAGTCTTCATTGTGACCAGAGCTCGTGAATACGAAGCCATAGCCAATAGCATAAATCTTTCAGGGAACAACATAAGCGGAGAGATCCCAAGAGAAATCTTAGGCCTCTTGTATCTCCGAATCCTGAATTTATCAAGAAACTCCATGGCAGGAAGCATTCCCGAGAAAATATCAGAACTGAGTCGCTTGGAGACGCTTGATCTATCAAAAAACAAGTTTTCTGGAGCCATACCTCAGAGCTTCGCAGCAATATCTTCTCTGCAAAGGCTGAATCTTTCGTTCAATAAACTGGAGGGGAGCATACCTAAGCTTCTCAAGTTTCAAGATCCATCCATTTACATTGGAAATGAATTACTCTGTGGGAAACCACTTCCTAAAAAATGTCCAAAAGACATTAAATAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MDLKLRPSFFISFLILILLLKNLNYGSAASPKCISTERQALLTFRAALTDLSSRLFSWSGPDCCNWPGVLCDARTSHVVKIDLRNPSQDVRSDEYKRGSLRGKIHPSLTQLKFLSYLDLSSNDFNELEIPEFIGQIVSLRYLNLSSSSFSGEIPTSLGNLSKLESLDLYAESFGDSGTLSLRASNLRWLSSLSSSLKYLNMGYVNLSGAGETWLQDFSRISALKELHLFNSELKNLPPTLSSSADLKLLEVLDLSENSLNSPIPNWLFGLTNLRKLFLRWDFLQGSIPTGFKNLKLLETLDLSNNLALQGEIPSVLGDLPQLKFLDLSANELNGQIHGFLDAFSRNKGNSLVFLDLSSNKLAGTLPESLGSLRNLQTLDLSSNSFTGSVPSSIGNMASLKKLDLSNNAMNGTIAESLGQLAELVDLNLMANTWGGVLQKSHFVNLRSLKSIRLTTEPYRSLVFKLPSTWIPPFRLELIQIENCRIGLFPMWLQVQTKLNFVTLRNTGIEDTIPDSWFSGISSKVTYLILANNRIKGRLPQKLAFPKLNTIDLSSNNFEGTFPLWSTNATELRLYENNFSGSLPQNIDVLMPRMEKIYLFSNSFTGNIPSSLCEVSGLQILSLRKNHFSGSFPKCWHRQFMLWGIDVSENNLSGEIPESLGMLPSLSVLLLNQNSLEGKIPESLRNCSGLTNIDLGGNKLTGKLPSWVGKLSSLFMLRLQSNSFTGQIPDDLCNVPNLRILDLSGNKISGPIPKCISNLTAIARGTNNEVFQNLVFIVTRAREYEAIANSINLSGNNISGEIPREILGLLYLRILNLSRNSMAGSIPEKISELSRLETLDLSKNKFSGAIPQSFAAISSLQRLNLSFNKLEGSIPKLLKFQDPSIYIGNELLCGKPLPKKCPKDIK

putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MDLKLRPSFFISFLILILLLKNLNYGSAASPKCISTERQALLTFRAALTDLSSRLFSWSGPDCCNWPGVLCDARTSHVVKIDLRNPSQDVRSDEYKRGSLRGKIHPSLTQLKFLSYLDLSSNDFNELEIPEFIGQIVSLRYLNLSSSSFSGEIPTSLGNLSKLESLDLYAESFGDSGTLSLRASNLRWLSSLSSSLKYLNMGYVNLSGAGETWLQDFSRISALKELHLFNSELKNLPPTLSSSADLKLLEVLDLSENSLNSPIPNWLFGLTNLRKLFLRWDFLQGSIPTGFKNLKLLETLDLSNNLALQGEIPSVLGDLPQLKFLDLSANELNGQIHGFLDAFSRNKGNSLVFLDLSSNKLAGTLPESLGSLRNLQTLDLSSNSFTGSVPSSIGNMASLKKLDLSNNAMNGTIAESLGQLAELVDLNLMANTWGGVLQKSHFVNLRSLKSIRLTTEPYRSLVFKLPSTWIPPFRLELIQIENCRIGLFPMWLQVQTKLNFVTLRNTGIEDTIPDSWFSGISSKVTYLILANNRIKGRLPQKLAFPKLNTIDLSSNNFEGTFPLWSTNATELRLYENNFSGSLPQNIDVLMPRMEKIYLFSNSFTGNIPSSLCEVSGLQILSLRKNHFSGSFPKCWHRQFMLWGIDVSENNLSGEIPESLGMLPSLSVLLLNQNSLEGKIPESLRNCSGLTNIDLGGNKLTGKLPSWVGKLSSLFMLRLQSNSFTGQIPDDLCNVPNLRILDLSGNKISGPIPKCISNLTAIARGTNNEVFQNLVFIVTRAREYEAIANSINLSGNNISGEIPREILGLLYLRILNLSRNSMAGSIPEKISELSRLETLDLSKNKFSGAIPQSFAAISSLQRLNLSFNKLEGSIPKLLKFQDPSIYIGNELLCGKPLPKKCPKDIK


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-899 PTHR24420,FAMILY NOT NAMED

MDLKLRPSFFISFLILILLLKNLNYGSAASPKCISTERQALLTFRAALTDLSSRLFSWSGPDCCNWPGVLCDARTSHVVKIDLRNPSQDVRSDEYKRGSLRGKIHPSLTQLKFLSYLDLSSNDFNELEIPEFIGQIVSLRYLNLSSSSFSGEIPTSLGNLSKLESLDLYAESFGDSGTLSLRASNLRWLSSLSSSLKYLNMGYVNLSGAGETWLQDFSRISALKELHLFNSELKNLPPTLSSSADLKLLEVLDLSENSLNSPIPNWLFGLTNLRKLFLRWDFLQGSIPTGFKNLKLLETLDLSNNLALQGEIPSVLGDLPQLKFLDLSANELNGQIHGFLDAFSRNKGNSLVFLDLSSNKLAGTLPESLGSLRNLQTLDLSSNSFTGSVPSSIGNMASLKKLDLSNNAMNGTIAESLGQLAELVDLNLMANTWGGVLQKSHFVNLRSLKSIRLTTEPYRSLVFKLPSTWIPPFRLELIQIENCRIGLFPMWLQVQTKLNFVTLRNTGIEDTIPDSWFSGISSKVTYLILANNRIKGRLPQKLAFPKLNTIDLSSNNFEGTFPLWSTNATELRLYENNFSGSLPQNIDVLMPRMEKIYLFSNSFTGNIPSSLCEVSGLQILSLRKNHFSGSFPKCWHRQFMLWGIDVSENNLSGEIPESLGMLPSLSVLLLNQNSLEGKIPESLRNCSGLTNIDLGGNKLTGKLPSWVGKLSSLFMLRLQSNSFTGQIPDDLCNVPNLRILDLSGNKISGPIPKCISNLTAIARGTNNEVFQNLVFIVTRAREYEAIANSINLSGNNISGEIPREILGLLYLRILNLSRNSMAGSIPEKISELSRLETLDLSKNKFSGAIPQSFAAISSLQRLNLSFNKLEGSIPKLLKFQDPSIYIGNELLCGKPLPKK

HMMPanther: PTHR24420:SF517
1-899 PTHR24420:SF517

MDLKLRPSFFISFLILILLLKNLNYGSAASPKCISTERQALLTFRAALTDLSSRLFSWSGPDCCNWPGVLCDARTSHVVKIDLRNPSQDVRSDEYKRGSLRGKIHPSLTQLKFLSYLDLSSNDFNELEIPEFIGQIVSLRYLNLSSSSFSGEIPTSLGNLSKLESLDLYAESFGDSGTLSLRASNLRWLSSLSSSLKYLNMGYVNLSGAGETWLQDFSRISALKELHLFNSELKNLPPTLSSSADLKLLEVLDLSENSLNSPIPNWLFGLTNLRKLFLRWDFLQGSIPTGFKNLKLLETLDLSNNLALQGEIPSVLGDLPQLKFLDLSANELNGQIHGFLDAFSRNKGNSLVFLDLSSNKLAGTLPESLGSLRNLQTLDLSSNSFTGSVPSSIGNMASLKKLDLSNNAMNGTIAESLGQLAELVDLNLMANTWGGVLQKSHFVNLRSLKSIRLTTEPYRSLVFKLPSTWIPPFRLELIQIENCRIGLFPMWLQVQTKLNFVTLRNTGIEDTIPDSWFSGISSKVTYLILANNRIKGRLPQKLAFPKLNTIDLSSNNFEGTFPLWSTNATELRLYENNFSGSLPQNIDVLMPRMEKIYLFSNSFTGNIPSSLCEVSGLQILSLRKNHFSGSFPKCWHRQFMLWGIDVSENNLSGEIPESLGMLPSLSVLLLNQNSLEGKIPESLRNCSGLTNIDLGGNKLTGKLPSWVGKLSSLFMLRLQSNSFTGQIPDDLCNVPNLRILDLSGNKISGPIPKCISNLTAIARGTNNEVFQNLVFIVTRAREYEAIANSINLSGNNISGEIPREILGLLYLRILNLSRNSMAGSIPEKISELSRLETLDLSKNKFSGAIPQSFAAISSLQRLNLSFNKLEGSIPKLLKFQDPSIYIGNELLCGKPLPKK

HMMPanther: PTHR24420
1-899 PTHR24420,FAMILY NOT NAMED

MDLKLRPSFFISFLILILLLKNLNYGSAASPKCISTERQALLTFRAALTDLSSRLFSWSGPDCCNWPGVLCDARTSHVVKIDLRNPSQDVRSDEYKRGSLRGKIHPSLTQLKFLSYLDLSSNDFNELEIPEFIGQIVSLRYLNLSSSSFSGEIPTSLGNLSKLESLDLYAESFGDSGTLSLRASNLRWLSSLSSSLKYLNMGYVNLSGAGETWLQDFSRISALKELHLFNSELKNLPPTLSSSADLKLLEVLDLSENSLNSPIPNWLFGLTNLRKLFLRWDFLQGSIPTGFKNLKLLETLDLSNNLALQGEIPSVLGDLPQLKFLDLSANELNGQIHGFLDAFSRNKGNSLVFLDLSSNKLAGTLPESLGSLRNLQTLDLSSNSFTGSVPSSIGNMASLKKLDLSNNAMNGTIAESLGQLAELVDLNLMANTWGGVLQKSHFVNLRSLKSIRLTTEPYRSLVFKLPSTWIPPFRLELIQIENCRIGLFPMWLQVQTKLNFVTLRNTGIEDTIPDSWFSGISSKVTYLILANNRIKGRLPQKLAFPKLNTIDLSSNNFEGTFPLWSTNATELRLYENNFSGSLPQNIDVLMPRMEKIYLFSNSFTGNIPSSLCEVSGLQILSLRKNHFSGSFPKCWHRQFMLWGIDVSENNLSGEIPESLGMLPSLSVLLLNQNSLEGKIPESLRNCSGLTNIDLGGNKLTGKLPSWVGKLSSLFMLRLQSNSFTGQIPDDLCNVPNLRILDLSGNKISGPIPKCISNLTAIARGTNNEVFQNLVFIVTRAREYEAIANSINLSGNNISGEIPREILGLLYLRILNLSRNSMAGSIPEKISELSRLETLDLSKNKFSGAIPQSFAAISSLQRLNLSFNKLEGSIPKLLKFQDPSIYIGNELLCGKPLPKK

HMMPanther: PTHR24420:SF517
1-899 PTHR24420:SF517

MDLKLRPSFFISFLILILLLKNLNYGSAASPKCISTERQALLTFRAALTDLSSRLFSWSGPDCCNWPGVLCDARTSHVVKIDLRNPSQDVRSDEYKRGSLRGKIHPSLTQLKFLSYLDLSSNDFNELEIPEFIGQIVSLRYLNLSSSSFSGEIPTSLGNLSKLESLDLYAESFGDSGTLSLRASNLRWLSSLSSSLKYLNMGYVNLSGAGETWLQDFSRISALKELHLFNSELKNLPPTLSSSADLKLLEVLDLSENSLNSPIPNWLFGLTNLRKLFLRWDFLQGSIPTGFKNLKLLETLDLSNNLALQGEIPSVLGDLPQLKFLDLSANELNGQIHGFLDAFSRNKGNSLVFLDLSSNKLAGTLPESLGSLRNLQTLDLSSNSFTGSVPSSIGNMASLKKLDLSNNAMNGTIAESLGQLAELVDLNLMANTWGGVLQKSHFVNLRSLKSIRLTTEPYRSLVFKLPSTWIPPFRLELIQIENCRIGLFPMWLQVQTKLNFVTLRNTGIEDTIPDSWFSGISSKVTYLILANNRIKGRLPQKLAFPKLNTIDLSSNNFEGTFPLWSTNATELRLYENNFSGSLPQNIDVLMPRMEKIYLFSNSFTGNIPSSLCEVSGLQILSLRKNHFSGSFPKCWHRQFMLWGIDVSENNLSGEIPESLGMLPSLSVLLLNQNSLEGKIPESLRNCSGLTNIDLGGNKLTGKLPSWVGKLSSLFMLRLQSNSFTGQIPDDLCNVPNLRILDLSGNKISGPIPKCISNLTAIARGTNNEVFQNLVFIVTRAREYEAIANSINLSGNNISGEIPREILGLLYLRILNLSRNSMAGSIPEKISELSRLETLDLSKNKFSGAIPQSFAAISSLQRLNLSFNKLEGSIPKLLKFQDPSIYIGNELLCGKPLPKK

superfamily: SSF52058
31-305 SSF52058,LRR

PKCISTERQALLTFRAALTDLSSRLFSWSGPDCCNWPGVLCDARTSHVVKIDLRNPSQDVRSDEYKRGSLRGKIHPSLTQLKFLSYLDLSSNDFNELEIPEFIGQIVSLRYLNLSSSSFSGEIPTSLGNLSKLESLDLYAESFGDSGTLSLRASNLRWLSSLSSSLKYLNMGYVNLSGAGETWLQDFSRISALKELHLFNSELKNLPPTLSSSADLKLLEVLDLSENSLNSPIPNWLFGLTNLRKLFLRWDFLQGSIPTGFKNLKLLETLDLSNN

superfamily: SSF52058
31-305 SSF52058,LRR

PKCISTERQALLTFRAALTDLSSRLFSWSGPDCCNWPGVLCDARTSHVVKIDLRNPSQDVRSDEYKRGSLRGKIHPSLTQLKFLSYLDLSSNDFNELEIPEFIGQIVSLRYLNLSSSSFSGEIPTSLGNLSKLESLDLYAESFGDSGTLSLRASNLRWLSSLSSSLKYLNMGYVNLSGAGETWLQDFSRISALKELHLFNSELKNLPPTLSSSADLKLLEVLDLSENSLNSPIPNWLFGLTNLRKLFLRWDFLQGSIPTGFKNLKLLETLDLSNN

Gene3D: G3DSA:3.80.10.10
32-343 G3DSA:3.80.10.10

KCISTERQALLTFRAALTDLSSRLFSWSGPDCCNWPGVLCDARTSHVVKIDLRNPSQDVRSDEYKRGSLRGKIHPSLTQLKFLSYLDLSSNDFNELEIPEFIGQIVSLRYLNLSSSSFSGEIPTSLGNLSKLESLDLYAESFGDSGTLSLRASNLRWLSSLSSSLKYLNMGYVNLSGAGETWLQDFSRISALKELHLFNSELKNLPPTLSSSADLKLLEVLDLSENSLNSPIPNWLFGLTNLRKLFLRWDFLQGSIPTGFKNLKLLETLDLSNNLALQGEIPSVLGDLPQLKFLDLSANELNGQIHGFLDAF

Gene3D: G3DSA:3.80.10.10
32-343 G3DSA:3.80.10.10

KCISTERQALLTFRAALTDLSSRLFSWSGPDCCNWPGVLCDARTSHVVKIDLRNPSQDVRSDEYKRGSLRGKIHPSLTQLKFLSYLDLSSNDFNELEIPEFIGQIVSLRYLNLSSSSFSGEIPTSLGNLSKLESLDLYAESFGDSGTLSLRASNLRWLSSLSSSLKYLNMGYVNLSGAGETWLQDFSRISALKELHLFNSELKNLPPTLSSSADLKLLEVLDLSENSLNSPIPNWLFGLTNLRKLFLRWDFLQGSIPTGFKNLKLLETLDLSNNLALQGEIPSVLGDLPQLKFLDLSANELNGQIHGFLDAF

HMMPfam: PF08263
IPR013210
36-72 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

TERQALLTFRAALTDLSSRLFSWSGPDCCNWPGVLCD

HMMPfam: PF08263
IPR013210
36-72 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

TERQALLTFRAALTDLSSRLFSWSGPDCCNWPGVLCD

ProfileScan: PS51450
IPR001611
113-134 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLSYLDLSSNDFNELEIPEFIG

ProfileScan: PS51450
IPR001611
113-134 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLSYLDLSSNDFNELEIPEFIG

HMMPfam: PF00560
IPR001611
138-160 LRR_1
Leucine-rich repeat

SLRYLNLSSSSFSGEIPTSLGNL

ProfileScan: PS51450
IPR001611
138-161 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRYLNLSSSSFSGEIPTSLGNLS

HMMPfam: PF00560
IPR001611
138-160 LRR_1
Leucine-rich repeat

SLRYLNLSSSSFSGEIPTSLGNL

ProfileScan: PS51450
IPR001611
138-161 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRYLNLSSSSFSGEIPTSLGNLS

ProfileScan: PS51450
IPR001611
222-243 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALKELHLFNSELKNLPPTLSSS

ProfileScan: PS51450
IPR001611
222-243 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALKELHLFNSELKNLPPTLSSS

HMMPfam: PF13855
222-280 LRR_8,Leucine rich repeat

ALKELHLFNSELKNLPPTLSSSADLKLLEVLDLSENSLNSPIPNWLFGLTNLRKLFLRW

HMMPfam: PF13855
222-280 LRR_8,Leucine rich repeat

ALKELHLFNSELKNLPPTLSSSADLKLLEVLDLSENSLNSPIPNWLFGLTNLRKLFLRW

ProfileScan: PS51450
IPR001611
248-271 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LLEVLDLSENSLNSPIPNWLFGLT

ProfileScan: PS51450
IPR001611
248-271 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LLEVLDLSENSLNSPIPNWLFGLT

ProfileScan: PS51450
IPR001611
296-320 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LLETLDLSNNLALQGEIPSVLGDLP

ProfileScan: PS51450
IPR001611
296-320 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LLETLDLSNNLALQGEIPSVLGDLP

HMMPfam: PF00560
IPR001611
297-317 LRR_1
Leucine-rich repeat

LETLDLSNNLALQGEIPSVLG

HMMPfam: PF00560
IPR001611
297-317 LRR_1
Leucine-rich repeat

LETLDLSNNLALQGEIPSVLG

superfamily: SSF52058
308-567 SSF52058,LRR

LQGEIPSVLGDLPQLKFLDLSANELNGQIHGFLDAFSRNKGNSLVFLDLSSNKLAGTLPESLGSLRNLQTLDLSSNSFTGSVPSSIGNMASLKKLDLSNNAMNGTIAESLGQLAELVDLNLMANTWGGVLQKSHFVNLRSLKSIRLTTEPYRSLVFKLPSTWIPPFRLELIQIENCRIGLFPMWLQVQTKLNFVTLRNTGIEDTIPDSWFSGISSKVTYLILANNRIKGRLPQKLAFPKLNTIDLSSNNFEGTFPLWSTN

superfamily: SSF52058
308-567 SSF52058,LRR

LQGEIPSVLGDLPQLKFLDLSANELNGQIHGFLDAFSRNKGNSLVFLDLSSNKLAGTLPESLGSLRNLQTLDLSSNSFTGSVPSSIGNMASLKKLDLSNNAMNGTIAESLGQLAELVDLNLMANTWGGVLQKSHFVNLRSLKSIRLTTEPYRSLVFKLPSTWIPPFRLELIQIENCRIGLFPMWLQVQTKLNFVTLRNTGIEDTIPDSWFSGISSKVTYLILANNRIKGRLPQKLAFPKLNTIDLSSNNFEGTFPLWSTN

ProfileScan: PS51450
IPR001611
321-343 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLKFLDLSANELNGQIHGFLDAF

ProfileScan: PS51450
IPR001611
321-343 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLKFLDLSANELNGQIHGFLDAF

Gene3D: G3DSA:3.80.10.10
349-575 G3DSA:3.80.10.10

NSLVFLDLSSNKLAGTLPESLGSLRNLQTLDLSSNSFTGSVPSSIGNMASLKKLDLSNNAMNGTIAESLGQLAELVDLNLMANTWGGVLQKSHFVNLRSLKSIRLTTEPYRSLVFKLPSTWIPPFRLELIQIENCRIGLFPMWLQVQTKLNFVTLRNTGIEDTIPDSWFSGISSKVTYLILANNRIKGRLPQKLAFPKLNTIDLSSNNFEGTFPLWSTNATELRLYE

Gene3D: G3DSA:3.80.10.10
349-575 G3DSA:3.80.10.10

NSLVFLDLSSNKLAGTLPESLGSLRNLQTLDLSSNSFTGSVPSSIGNMASLKKLDLSNNAMNGTIAESLGQLAELVDLNLMANTWGGVLQKSHFVNLRSLKSIRLTTEPYRSLVFKLPSTWIPPFRLELIQIENCRIGLFPMWLQVQTKLNFVTLRNTGIEDTIPDSWFSGISSKVTYLILANNRIKGRLPQKLAFPKLNTIDLSSNNFEGTFPLWSTNATELRLYE

ProfileScan: PS51450
IPR001611
350-372 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLVFLDLSSNKLAGTLPESLGSL

ProfileScan: PS51450
IPR001611
350-372 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLVFLDLSSNKLAGTLPESLGSL

HMMPfam: PF13855
350-407 LRR_8,Leucine rich repeat

SLVFLDLSSNKLAGTLPESLGSLRNLQTLDLSSNSFTGSVPSSIGNMASLKKLDLSNN

HMMPfam: PF13855
350-407 LRR_8,Leucine rich repeat

SLVFLDLSSNKLAGTLPESLGSLRNLQTLDLSSNSFTGSVPSSIGNMASLKKLDLSNN

FPrintScan: PR00019
351-364 LEURICHRPT,Leucine-rich repeat signature

LVFLDLSSNKLAGT

FPrintScan: PR00019
351-364 LEURICHRPT,Leucine-rich repeat signature

LVFLDLSSNKLAGT

ProfileScan: PS51450
IPR001611
374-396 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQTLDLSSNSFTGSVPSSIGNM

ProfileScan: PS51450
IPR001611
374-396 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQTLDLSSNSFTGSVPSSIGNM

ProfileScan: PS51450
IPR001611
398-420 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKKLDLSNNAMNGTIAESLGQL

ProfileScan: PS51450
IPR001611
398-420 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKKLDLSNNAMNGTIAESLGQL

ProfileScan: PS51450
IPR001611
523-545 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KVTYLILANNRIKGRLPQKLAFP

ProfileScan: PS51450
IPR001611
523-545 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KVTYLILANNRIKGRLPQKLAFP

ProfileScan: PS51450
IPR001611
546-567 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLNTIDLSSNNFEGTFPLWSTN

ProfileScan: PS51450
IPR001611
546-567 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLNTIDLSSNNFEGTFPLWSTN

superfamily: SSF52047
570-879 SSF52047,LRR

ELRLYENNFSGSLPQNIDVLMPRMEKIYLFSNSFTGNIPSSLCEVSGLQILSLRKNHFSGSFPKCWHRQFMLWGIDVSENNLSGEIPESLGMLPSLSVLLLNQNSLEGKIPESLRNCSGLTNIDLGGNKLTGKLPSWVGKLSSLFMLRLQSNSFTGQIPDDLCNVPNLRILDLSGNKISGPIPKCISNLTAIARGTNNEVFQNLVFIVTRAREYEAIANSINLSGNNISGEIPREILGLLYLRILNLSRNSMAGSIPEKISELSRLETLDLSKNKFSGAIPQSFAAISSLQRLNLSFNKLEGSIPKLLKF

superfamily: SSF52047
570-879 SSF52047,LRR

ELRLYENNFSGSLPQNIDVLMPRMEKIYLFSNSFTGNIPSSLCEVSGLQILSLRKNHFSGSFPKCWHRQFMLWGIDVSENNLSGEIPESLGMLPSLSVLLLNQNSLEGKIPESLRNCSGLTNIDLGGNKLTGKLPSWVGKLSSLFMLRLQSNSFTGQIPDDLCNVPNLRILDLSGNKISGPIPKCISNLTAIARGTNNEVFQNLVFIVTRAREYEAIANSINLSGNNISGEIPREILGLLYLRILNLSRNSMAGSIPEKISELSRLETLDLSKNKFSGAIPQSFAAISSLQRLNLSFNKLEGSIPKLLKF

Gene3D: G3DSA:3.80.10.10
576-760 G3DSA:3.80.10.10

NNFSGSLPQNIDVLMPRMEKIYLFSNSFTGNIPSSLCEVSGLQILSLRKNHFSGSFPKCWHRQFMLWGIDVSENNLSGEIPESLGMLPSLSVLLLNQNSLEGKIPESLRNCSGLTNIDLGGNKLTGKLPSWVGKLSSLFMLRLQSNSFTGQIPDDLCNVPNLRILDLSGNKISGPIPKCISNLTA

Gene3D: G3DSA:3.80.10.10
576-760 G3DSA:3.80.10.10

NNFSGSLPQNIDVLMPRMEKIYLFSNSFTGNIPSSLCEVSGLQILSLRKNHFSGSFPKCWHRQFMLWGIDVSENNLSGEIPESLGMLPSLSVLLLNQNSLEGKIPESLRNCSGLTNIDLGGNKLTGKLPSWVGKLSSLFMLRLQSNSFTGQIPDDLCNVPNLRILDLSGNKISGPIPKCISNLTA

ProfileScan: PS51450
IPR001611
664-686 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLSVLLLNQNSLEGKIPESLRNC

ProfileScan: PS51450
IPR001611
664-686 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLSVLLLNQNSLEGKIPESLRNC

ProfileScan: PS51450
IPR001611
688-710 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLTNIDLGGNKLTGKLPSWVGKL

ProfileScan: PS51450
IPR001611
688-710 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLTNIDLGGNKLTGKLPSWVGKL

HMMPfam: PF13855
688-747 LRR_8,Leucine rich repeat

GLTNIDLGGNKLTGKLPSWVGKLSSLFMLRLQSNSFTGQIPDDLCNVPNLRILDLSGNKI

HMMPfam: PF13855
688-747 LRR_8,Leucine rich repeat

GLTNIDLGGNKLTGKLPSWVGKLSSLFMLRLQSNSFTGQIPDDLCNVPNLRILDLSGNKI

FPrintScan: PR00019
734-747 LEURICHRPT,Leucine-rich repeat signature

VPNLRILDLSGNKI

FPrintScan: PR00019
734-747 LEURICHRPT,Leucine-rich repeat signature

VPNLRILDLSGNKI

ProfileScan: PS51450
IPR001611
736-759 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRILDLSGNKISGPIPKCISNLT

ProfileScan: PS51450
IPR001611
736-759 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRILDLSGNKISGPIPKCISNLT

Gene3D: G3DSA:3.80.10.10
789-877 G3DSA:3.80.10.10

SINLSGNNISGEIPREILGLLYLRILNLSRNSMAGSIPEKISELSRLETLDLSKNKFSGAIPQSFAAISSLQRLNLSFNKLEGSIPKLL

Gene3D: G3DSA:3.80.10.10
789-877 G3DSA:3.80.10.10

SINLSGNNISGEIPREILGLLYLRILNLSRNSMAGSIPEKISELSRLETLDLSKNKFSGAIPQSFAAISSLQRLNLSFNKLEGSIPKLL

ProfileScan: PS51450
IPR001611
810-832 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLRILNLSRNSMAGSIPEKISEL

ProfileScan: PS51450
IPR001611
810-832 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLRILNLSRNSMAGSIPEKISEL

HMMPfam: PF13855
811-869 LRR_8,Leucine rich repeat

LRILNLSRNSMAGSIPEKISELSRLETLDLSKNKFSGAIPQSFAAISSLQRLNLSFNKL

HMMPfam: PF13855
811-869 LRR_8,Leucine rich repeat

LRILNLSRNSMAGSIPEKISELSRLETLDLSKNKFSGAIPQSFAAISSLQRLNLSFNKL

ProfileScan: PS51450
IPR001611
834-855 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLETLDLSKNKFSGAIPQSFAA

ProfileScan: PS51450
IPR001611
834-855 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLETLDLSKNKFSGAIPQSFAA

ProfileScan: PS51450
IPR001611
858-880 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQRLNLSFNKLEGSIPKLLKFQ

ProfileScan: PS51450
IPR001611
858-880 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQRLNLSFNKLEGSIPKLLKFQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox