PRGDB00062200 (putative disease resistance protein OB3)

From PRG Wiki
Jump to: navigation, search
putative disease resistance protein OB3
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 13937093 (AF363801)
Gene Class NL
Domain Type NBS, LRR
Gene Species Phaseolus vulgaris

Comment?

Phaseolus vulgaris putative disease resistance protein OB3 (RGA) gene, partial cds.

DNA Sequence

GGGGGGATGGGGAAGACGACAATTGCTAGATTAGTCTATGAAGCAGTCAAAGAGAAATTCAAGGTTAGTTGCTTTCTTGAAAACATCAGAGAATTGTCCAAGACAAATGGCTTAGTTCACATTCAAAAGGAAATTCTTTCTCATCTTAATGTAAGAAGCAATGATTTTTGTAATCTTTATGATGGGAAAAAGATAATAGCAAACTCTTTAAGCAACAAAAAGGTACTTCTTGTTCTTGATGATGTAAGTCACATAAGCCAATTGGAGAATTTAGGTGGAAAAAGAGAATGGTTTGGTCCAGGAAGCAGACTAATAATCACAACTAGAGATAAGCACCTGCTAAAGACATATGGAGTGGATATGACTTATAAGGCTAGAGGCTTAGCCCAAAATGAAGCCCTTCAGCTCTTTTGCTTGACAGCATTTAAACAAGACCAACCTAAAGAAGGGTATTTCACTTTCTGCAAAGGAGTGGTTGAATATGCAACGCTCCCTCGCTCA


Protein sequences

Name Description Sequence
putative disease resistance protein OB3 putative disease resistance protein OB3 [Phaseolus vulgaris].

GGMGKTTIARLVYEAVKEKFKVSCFLENIRELSKTNGLVHIQKEILSHLNVRSNDFCNLYDGKKIIANSLSNKKVLLVLDDVSHISQLENLGGKREWFGPGSRLIITTRDKHLLKTYGVDMTYKARGLAQNEALQLFCLTAFKQDQPKEGYFTFCKGVVEYATLPRS


Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-147 SSF52540

GGMGKTTIARLVYEAVKEKFKVSCFLENIRELSKTNGLVHIQKEILSHLNVRSNDFCNLYDGKKIIANSLSNKKVLLVLDDVSHISQLENLGGKREWFGPGSRLIITTRDKHLLKTYGVDMTYKARGLAQNEALQLFCLTAFKQDQP

HMMPanther: PTHR11017:SF20
1-162 PTHR11017:SF20,SUBFAMILY NOT NAMED

GGMGKTTIARLVYEAVKEKFKVSCFLENIRELSKTNGLVHIQKEILSHLNVRSNDFCNLYDGKKIIANSLSNKKVLLVLDDVSHISQLENLGGKREWFGPGSRLIITTRDKHLLKTYGVDMTYKARGLAQNEALQLFCLTAFKQDQPKEGYFTFCKGVVEYA

HMMPanther: PTHR11017
1-162 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGMGKTTIARLVYEAVKEKFKVSCFLENIRELSKTNGLVHIQKEILSHLNVRSNDFCNLYDGKKIIANSLSNKKVLLVLDDVSHISQLENLGGKREWFGPGSRLIITTRDKHLLKTYGVDMTYKARGLAQNEALQLFCLTAFKQDQPKEGYFTFCKGVVEYA

HMMPfam: PF00931
IPR002182
1-146 NB-ARC,NBS
NB-ARC

GGMGKTTIARLVYEAVKEKFKVSCFLENIRELSKTNGLVHIQKEILSHLNVRSNDFCNLYDGKKIIANSLSNKKVLLVLDDVSHISQLENLGGKREWFGPGSRLIITTRDKHLLKTYGVDMTYKARGLAQNEALQLFCLTAFKQDQ

Gene3D: G3DSA:3.40.50.300
2-117 G3DSA:3.40.50.300

GMGKTTIARLVYEAVKEKFKVSCFLENIRELSKTNGLVHIQKEILSHLNVRSNDFCNLYDGKKIIANSLSNKKVLLVLDDVSHISQLENLGGKREWFGPGSRLIITTRDKHLLKTY


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox