PRGDB00062211 (Disease resistance protein RPM1, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RPM1, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255582946 (XM_002532198)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RPM1, putative, mRNA.

DNA Sequence

ATGGCAGAAGCTGCAGTGGGTTGGGCAATTAATAAGTTGGATACATTGTTAACCGGAGAGGTGAAACTGCTCAGAAATGTCCATACGGAGCTTCAAGGACTCAGAGATGAACTTGAGGCAATTGAATCATTCCTGAGAGATGCAGATGTGAGGTTTTATCAAGAGAATTCGGATAGCCGTATTAAAACATGGGTAAAACAAGTTAGACAGGTTGCTTTTGAAATAGAAGATGCCATTGATGTATACATGCTTCATCTTGTACGACACCAAGATCAGCATGGCTTTTTTCATAAAATCAGTCGACTTGTCAGAAAGTTAAAGCCACGTCATGAGATAGCCTCAAAGATTCAAGACCTCAAGAAATCAGTTTGTGAAATAAGGGAAAGAAGTGATAGATACAAGTTCAATTTATCATCAGAGCAAGGAAGCAGTGACAGGGATAACACATGGCATGACCCTAGAGTTCATTCCCTTTTCATTGACGAAGCTGAACTTGTTGGTATTGAATCTCCTAAAGCTGAATTGATAAGCAAATTAGTAGAGGGAGCTTCTGAAAATGTTGTCATCTCTGTGGTGGGCATGGGAGGATTAGGCAAAACCACTCTTGCCAAGAAAGTATTTGACTCTGAAAGAGTAACTGTATATTTTGATTGCAAGGCGTGGATCACGGTGACTCAATCCTACAAGATGGCAAAGCTACTAAGGATTATGATACGGCAACTACATCAAGAAAATGTGCTACCTGCATTTGAAGGAACTGACACGATGAGCGAGTTGTCGCTGATTGAGAAATTGAGAGAATATTTAATAGAGAAAAGGTATTTGGTGATCTTTGATGATGTTTGGGATATTTTTTTATGGGGGTATATAATGACTGCATTACCTAATAATGGCAAAGGTAATAGAATTATCATTACAACTCGTAATGAAGGTGTTGCCCCTTCTCCGAACGAGTCTCCATTTTATTATGTCTTCAAACTTCAACTTCTACCTAAAAGAGAAGCCTATGAGCTCTTCTGCAAGAAGGTATTTCAGTCAAATGGTGGAAATTGTCCATCACAGTTGCAAGAGTTATCTCATGCCATTGTAGAAAAGTGTGAAGGTTTGCCCCTTGCCATCGTGACAATAGGTGGTGTATTGGCAACTAAAGAGAAGTTGGTTACAGAGTGGAAAAAATTCTATGATGACCTCACTTCATCCTTGGCAAGTGATCAACGTCTCTCAAATATCATAAAAATCTTATCACTAAGTTATCAGGATCTGCCTTACTATCTTAAATCTTGTTTTTTATATTTCAACCTATTTCCAGAGAATTGCTCCATTAATTGTTGGAGATTAATTCGATTGTGGATAGCTGATGGCTTAATAAAAGAAAGACAAGGCAGAATAGTGGAAGAAGTAGCCGAAGAATACTTAATTGAACTTGTTCATAGAAGGTTGGTTCAAGTAGAAAGGGTTAGTTTTGACAGTAAGGCCAGAGAATGTAGGGTCCATGATTTGATGCGGGAGATAATTCTTTTCCAGTCGAGAGAGTTAAGCTTTCATCAAGTTTCAAGTAAGGATTATCAGAATTTGAAGGGAAGAAGTCGACACCTTTCAATCAATGACAAAGTGAAGAATATTTTAGAGAGCAATTGTAATTCTCAAACTCATTCTATTATTCTTTTTGAGTCAAATGAATTGCCAAAATCTTTTATTACTTCAGTCATAGATGATTTCAAGCTTTTAAGATCATTGGATCTTGAAGGAGCTCCTCTAGACTACATTCCTGATGAAGTTGGAAATTTATGGCATTTGAAATATTTATGCCTAAAAGATACCAATGTAAAAGTGCTACCAAAGTCCATTGGTAAATTATGCAACCTGGAGACTTTAGATTTGAGACAGTCCCTTGTATTGGATCTCCCAATTGAGATCAATAGGCTCCTTAAGTTGCGACACCTTTTAGCCTACTTTTTCAATTATGATAATGAGTTTTATATTAATTCATTACGTGCGGTGAAGATGCATGGAAATATTGGAAGTCTAAAGGCCTTACAAAAGCTGAGTTACATTGAAGCAGACCATGGCGTGGACCTAATTAGACAAATTGAAAGGTTGACACAGTTGCGAAAGCTAGGGATCACAAAATTGAAAAAAGAAAATGGATTGGATTTGTGCTATGCCTTGGAGAAGATGTCTTGCCTTCAAACATTGAAAGTTTCTTCAGGAAGTGTGGAGGAATTTCTAGACTTGAGATCAATATCAGGTCCTCCTCTGCTTCAATATTTGTACCTAAGTGGACCATTAGTAGAGCTCCCACCTTGGATTTCGAAACTATCATGTTTGGTTAAACTTGTATTCAATTGGTCGAGATTAGGGAATGATGCTATACAGGTCCTACAAGCTTTACCTAATCTACAAATGTTAAGATTTTATGAGGGATGCAATGCAAAGCAACTGCATTTTACGAAAGGATGCTTTTCCAATCTTAAGATGTTGCATCTTCTGCACTTGACTCGATTGAATAAACTGATAATAGATGAAGGTGGATTGCCTGTAATTGAAGAGCTAAGTATTGGGCCTTGCCCAAAGTTGAAAGAGTTGCCATCCGGCATCCATTATCTAAGAAATCTCAAGAGGCTAGAATTTTATGACATACAAAGAGAATTTGCAATTGGAATGCAACCACTTGGAGGTCATGAATATTGTAAAGTTCAGAACATACCACTCATCCTTTTCTACTACAAGTTCAAAGGATACACATTCAATCAATACAAGCTTGGCAATATAAACTTGCTTAAGCGCTTGATGGAAGTCTCGGAATGA


Protein sequences

Name Description Sequence
Disease resistance protein RPM1, putative Disease resistance protein RPM1, putative [Ricinus communis].

MAEAAVGWAINKLDTLLTGEVKLLRNVHTELQGLRDELEAIESFLRDADVRFYQENSDSRIKTWVKQVRQVAFEIEDAIDVYMLHLVRHQDQHGFFHKISRLVRKLKPRHEIASKIQDLKKSVCEIRERSDRYKFNLSSEQGSSDRDNTWHDPRVHSLFIDEAELVGIESPKAELISKLVEGASENVVISVVGMGGLGKTTLAKKVFDSERVTVYFDCKAWITVTQSYKMAKLLRIMIRQLHQENVLPAFEGTDTMSELSLIEKLREYLIEKRYLVIFDDVWDIFLWGYIMTALPNNGKGNRIIITTRNEGVAPSPNESPFYYVFKLQLLPKREAYELFCKKVFQSNGGNCPSQLQELSHAIVEKCEGLPLAIVTIGGVLATKEKLVTEWKKFYDDLTSSLASDQRLSNIIKILSLSYQDLPYYLKSCFLYFNLFPENCSINCWRLIRLWIADGLIKERQGRIVEEVAEEYLIELVHRRLVQVERVSFDSKARECRVHDLMREIILFQSRELSFHQVSSKDYQNLKGRSRHLSINDKVKNILESNCNSQTHSIILFESNELPKSFITSVIDDFKLLRSLDLEGAPLDYIPDEVGNLWHLKYLCLKDTNVKVLPKSIGKLCNLETLDLRQSLVLDLPIEINRLLKLRHLLAYFFNYDNEFYINSLRAVKMHGNIGSLKALQKLSYIEADHGVDLIRQIERLTQLRKLGITKLKKENGLDLCYALEKMSCLQTLKVSSGSVEEFLDLRSISGPPLLQYLYLSGPLVELPPWISKLSCLVKLVFNWSRLGNDAIQVLQALPNLQMLRFYEGCNAKQLHFTKGCFSNLKMLHLLHLTRLNKLIIDEGGLPVIEELSIGPCPKLKELPSGIHYLRNLKRLEFYDIQREFAIGMQPLGGHEYCKVQNIPLILFYYKFKGYTFNQYKLGNINLLKRLMEVSE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
10-902 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

INKLDTLLTGEVKLLRNVHTELQGLRDELEAIESFLRDADVRFYQENSDSRIKTWVKQVRQVAFEIEDAIDVYMLHLVRHQDQHGFFHKISRLVRKLKPRHEIASKIQDLKKSVCEIRERSDRYKFNLSSEQGSSDRDNTWHDPRVHSLFIDEAELVGIESPKAELISKLVEGASENVVISVVGMGGLGKTTLAKKVFDSERVTVYFDCKAWITVTQSYKMAKLLRIMIRQLHQENVLPAFEGTDTMSELSLIEKLREYLIEKRYLVIFDDVWDIFLWGYIMTALPNNGKGNRIIITTRNEGVAPSPNESPFYYVFKLQLLPKREAYELFCKKVFQSNGGNCPSQLQELSHAIVEKCEGLPLAIVTIGGVLATKEKLVTEWKKFYDDLTSSLASDQRLSNIIKILSLSYQDLPYYLKSCFLYFNLFPENCSINCWRLIRLWIADGLIKERQGRIVEEVAEEYLIELVHRRLVQVERVSFDSKARECRVHDLMREIILFQSRELSFHQVSSKDYQNLKGRSRHLSINDKVKNILESNCNSQTHSIILFESNELPKSFITSVIDDFKLLRSLDLEGAPLDYIPDEVGNLWHLKYLCLKDTNVKVLPKSIGKLCNLETLDLRQSLVLDLPIEINRLLKLRHLLAYFFNYDNEFYINSLRAVKMHGNIGSLKALQKLSYIEADHGVDLIRQIERLTQLRKLGITKLKKENGLDLCYALEKMSCLQTLKVSSGSVEEFLDLRSISGPPLLQYLYLSGPLVELPPWISKLSCLVKLVFNWSRLGNDAIQVLQALPNLQMLRFYEGCNAKQLHFTKGCFSNLKMLHLLHLTRLNKLIIDEGGLPVIEELSIGPCPKLKELPSGIHYLRNLKRLEFYDIQREFAIGMQPLGGHEYCKVQNI

superfamily: SSF52540
148-404 SSF52540

NTWHDPRVHSLFIDEAELVGIESPKAELISKLVEGASENVVISVVGMGGLGKTTLAKKVFDSERVTVYFDCKAWITVTQSYKMAKLLRIMIRQLHQENVLPAFEGTDTMSELSLIEKLREYLIEKRYLVIFDDVWDIFLWGYIMTALPNNGKGNRIIITTRNEGVAPSPNESPFYYVFKLQLLPKREAYELFCKKVFQSNGGNCPSQLQELSHAIVEKCEGLPLAIVTIGGVLATKEKLVTEWKKFYDDLTSSLASD

Gene3D: G3DSA:3.40.50.300
162-329 G3DSA:3.40.50.300

EAELVGIESPKAELISKLVEGASENVVISVVGMGGLGKTTLAKKVFDSERVTVYFDCKAWITVTQSYKMAKLLRIMIRQLHQENVLPAFEGTDTMSELSLIEKLREYLIEKRYLVIFDDVWDIFLWGYIMTALPNNGKGNRIIITTRNEGVAPSPNESPFYYVFKLQL

HMMPfam: PF00931
IPR002182
169-459 NB-ARC,NBS
NB-ARC

ESPKAELISKLVEGASENVVISVVGMGGLGKTTLAKKVFDSERVTVYFDCKAWITVTQSYKMAKLLRIMIRQLHQENVLPAFEGTDTMSELSLIEKLREYLIEKRYLVIFDDVWDIFLWGYIMTALPNNGKGNRIIITTRNEGVAPSPNESPFYYVFKLQLLPKREAYELFCKKVFQSNGGNCPSQLQELSHAIVEKCEGLPLAIVTIGGVLATKEKLVTEWKKFYDDLTSSLASDQRLSNIIKILSLSYQDLPYYLKSCFLYFNLFPENCSINCWRLIRLWIADGLIKER

FPrintScan: PR00364
IPR000767
188-203 DISEASERSIST
Disease resistance protein

VISVVGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
268-282 DISEASERSIST
Disease resistance protein

YLIEKRYLVIFDDVW

FPrintScan: PR00364
IPR000767
366-380 DISEASERSIST
Disease resistance protein

CEGLPLAIVTIGGVL

superfamily: SSF52058
496-925 SSF52058,LRR

RVHDLMREIILFQSRELSFHQVSSKDYQNLKGRSRHLSINDKVKNILESNCNSQTHSIILFESNELPKSFITSVIDDFKLLRSLDLEGAPLDYIPDEVGNLWHLKYLCLKDTNVKVLPKSIGKLCNLETLDLRQSLVLDLPIEINRLLKLRHLLAYFFNYDNEFYINSLRAVKMHGNIGSLKALQKLSYIEADHGVDLIRQIERLTQLRKLGITKLKKENGLDLCYALEKMSCLQTLKVSSGSVEEFLDLRSISGPPLLQYLYLSGPLVELPPWISKLSCLVKLVFNWSRLGNDAIQVLQALPNLQMLRFYEGCNAKQLHFTKGCFSNLKMLHLLHLTRLNKLIIDEGGLPVIEELSIGPCPKLKELPSGIHYLRNLKRLEFYDIQREFAIGMQPLGGHEYCKVQNIPLILFYYKFKGYTFNQYKLGNIN

Gene3D: G3DSA:3.80.10.10
563-649 G3DSA:3.80.10.10

KSFITSVIDDFKLLRSLDLEGAPLDYIPDEVGNLWHLKYLCLKDTNVKVLPKSIGKLCNLETLDLRQSLVLDLPIEINRLLKLRHLL

FPrintScan: PR00364
IPR000767
617-633 DISEASERSIST
Disease resistance protein

GKLCNLETLDLRQSLVL

Gene3D: G3DSA:3.80.10.10
673-879 G3DSA:3.80.10.10

IGSLKALQKLSYIEADHGVDLIRQIERLTQLRKLGITKLKKENGLDLCYALEKMSCLQTLKVSSGSVEEFLDLRSISGPPLLQYLYLSGPLVELPPWISKLSCLVKLVFNWSRLGNDAIQVLQALPNLQMLRFYEGCNAKQLHFTKGCFSNLKMLHLLHLTRLNKLIIDEGGLPVIEELSIGPCPKLKELPSGIHYLRNLKRLEFYD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox