PRGDB00062213 (Disease resistance protein RPM1, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RPM1, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255581163 (XM_002531349)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RPM1, putative, mRNA.

DNA Sequence

ATGGCCATGATACCAGTAGAATTAGTGCTAGAGCAACTAGCTTTTCTTGTTGCAGAAGAGACTCGTCTGCTAAAGGGAGTTCGCGGGGGAATCGATATACTTCAGGATGATTTATACAGCATGAAAGCTTTCCTGCAGGATGCAGAGGCAAGAAGTGAGAAAGATGAAGGAGTGAAAGCATGGGTGAAACAAGTAAGGGATGTGGCTTATGATGCTGAAGATGTTCTTGAAGAATTTATGCTCCGGCTACCACCAGTAAATGGTCATGGTTTTATCCATTCTCTCCGCAATTGGTATTATCAGATCCGGAGTTTAAGGGCACAACGCCGCTTAGCTATTCAGATACAAAGCATTAAGCGAAGAGTGAAAGCCATTTCAGAGAGGAGGAATGCGTTTTCATTCAATAGGTTAGACATGGGAACATGCTCAAATGTTCCTGTGGAACCCCTCCGGCTGGCTTCGCTCTACATAGATGAAGCTGATCTGGTGGGAATTGAAACCCCTAAAAGTCAATTGGTCGCATGGCTCATAGAGGGAGAAGAAAAGCTTACCTCGATCTCTGTGGTTGGGATGGGCGTCTTAGGAAAAACAACCCTGGTAAAGAAAGTCTATGACAGCCAACTTATCGAAAGAAGCTTTGACTGCTATTGCTGGATTACTGTCTCCAAGTCATTTAGCCACACAGAGCTTCTACGAGCTGCACTTCAAGGCTTTCTAGAGGCAACAAAGGAACCAGCACCGGAGGGAATGGAGTTAATGACCGATTTCCAATTAGTTGATGCAATCAGGACACTTCTCCAGCAGAAGAGGTACATAATCGTCTTTGATGATGTATTGAGTGTGGACGCTTGGGATGCAATAATGTACGCATTCCCCGATTGTAATTCTGGCAGTAGAATTATCTTCACAACAAGATCAAGCAATGTAGCAGCATCTTTAGAGATTACTAATCGTGTTTATCATCTACAACTCTTAACACAGTCAGAGGCTTGGACCCTCTTCTGTAGAAAGGCCTTCAGAGCGGAACATAAAGGTGTATGTCCTGTAGAGCTAGAAGAGTTGTCTAGAGGTATCTTGAGGAGGTGTGAGGAGTTGCCACTCGCAATTGTAGCTATAGGAGGTATGCTATCGAAGAAGATTAAAGTGGGTTCAGAGTGGAGGAAAGTGCATGATAGCTTAGCTGCTGAATTCAGAAATGACAACAACCTTGGGAGTTTACAGAGAATGCTTCTATTGAGTTACAATGATCTTCCACATTACCTTAAACTATGTTACTTGTATTTAAGTGTGTTCCCTGAGGATTACTTAATTAGAAGAACGAATTTGGTCCGACTATGGGTAGTTGAAAGGATTGTGAAAGAAAAGCAAGGACTAACAATGGAGGAAGCAGCAGAGGACTACTTTAATGAACTCGTTAGCAGGAGTATGATTCAAGTAGTAGAAGTGGATTTTTCCTATAGGGTCAAAACATGTCGGCTTCATGATCTAATGCGAGAAATAATCCAATTAAAATCCAAGGAAGAATCATTTGTTGTGATAGCAAATGAAAGAGGCATCAGAACAAATGATAAAGTTCATCGATTATCGATCCATGATAATCCCAAGGAATTATCATCAGGTATCAGATTTCCATATCTTCGATCTCTGCTTCTATTTACGCCAACCGATTCTGTCGCCTGCTTCGGGCATGCTCTGTTTCGTGATTTCAAGTTATTAAGAGTCTTGGAGCTAGAAAATCTGCCTCTTTTGAGTTTTCCACCCGAGTTGATTGGATTGATTCATTTGAGGTACTTAAGTTTGAGAAGAACAATGATAACAGTGCTTCCAGAGTCCATAAGAAAGCTTAAGAACCTCGAAATACTGGATCTGAAAAGAAGTCTCGTATCATCCCTACCCTACGGGATATTGGAGCTGAAAAATCTTCGCCAGCTCCACGTACACGGAATGAGAGTGCCACCAGGAATAGGAAGACTGACGAGCATACAGAAATTAGGAACCATTGAAGTGAATGATGATTGTGAGTTAGTGAAGGAGTTGGGAAAGTTAACTCAGCTTCGGAGGTTGGGAGTTGGATCGGTAAGAAAAGAACATGGGAAGGATCTATGTTATAGTTTGGACAGGATGAAACATCTTACTGCATTGTTCTTGGTTTCAATGAACCGAGATGAACTTTTATGTCTGGACTCTGTTGCGTCACCTCCCACAAATCTTCAATGTCTATACCTTAATGGTTGTTTGTTGACTTTACCTAAATGGATAGCGTCACTTCGCTATCTTTCCAAGCTCGTCTTTCAATTTTCTAAATTGCAGAACGACCCACTTAAAGCCCTCCAGGATTTGCCTAGCTTAGTGGTGCTTGAAATCAGAGAAGCTTATGATGGAGAAGAACTATGCTGTGATGCTAGAGGTTTCTCAAGGCTTAAGAAGCTTGGTCTTTATCAACTCAAAAGCTTGCAGAGCATAAAATTGGCGGAAGGAGCAATGCCTGGACTATAG


Protein sequences

Name Description Sequence
Disease resistance protein RPM1, putative Disease resistance protein RPM1, putative [Ricinus communis].

MAMIPVELVLEQLAFLVAEETRLLKGVRGGIDILQDDLYSMKAFLQDAEARSEKDEGVKAWVKQVRDVAYDAEDVLEEFMLRLPPVNGHGFIHSLRNWYYQIRSLRAQRRLAIQIQSIKRRVKAISERRNAFSFNRLDMGTCSNVPVEPLRLASLYIDEADLVGIETPKSQLVAWLIEGEEKLTSISVVGMGVLGKTTLVKKVYDSQLIERSFDCYCWITVSKSFSHTELLRAALQGFLEATKEPAPEGMELMTDFQLVDAIRTLLQQKRYIIVFDDVLSVDAWDAIMYAFPDCNSGSRIIFTTRSSNVAASLEITNRVYHLQLLTQSEAWTLFCRKAFRAEHKGVCPVELEELSRGILRRCEELPLAIVAIGGMLSKKIKVGSEWRKVHDSLAAEFRNDNNLGSLQRMLLLSYNDLPHYLKLCYLYLSVFPEDYLIRRTNLVRLWVVERIVKEKQGLTMEEAAEDYFNELVSRSMIQVVEVDFSYRVKTCRLHDLMREIIQLKSKEESFVVIANERGIRTNDKVHRLSIHDNPKELSSGIRFPYLRSLLLFTPTDSVACFGHALFRDFKLLRVLELENLPLLSFPPELIGLIHLRYLSLRRTMITVLPESIRKLKNLEILDLKRSLVSSLPYGILELKNLRQLHVHGMRVPPGIGRLTSIQKLGTIEVNDDCELVKELGKLTQLRRLGVGSVRKEHGKDLCYSLDRMKHLTALFLVSMNRDELLCLDSVASPPTNLQCLYLNGCLLTLPKWIASLRYLSKLVFQFSKLQNDPLKALQDLPSLVVLEIREAYDGEELCCDARGFSRLKKLGLYQLKSLQSIKLAEGAMPGL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
19-831 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EETRLLKGVRGGIDILQDDLYSMKAFLQDAEARSEKDEGVKAWVKQVRDVAYDAEDVLEEFMLRLPPVNGHGFIHSLRNWYYQIRSLRAQRRLAIQIQSIKRRVKAISERRNAFSFNRLDMGTCSNVPVEPLRLASLYIDEADLVGIETPKSQLVAWLIEGEEKLTSISVVGMGVLGKTTLVKKVYDSQLIERSFDCYCWITVSKSFSHTELLRAALQGFLEATKEPAPEGMELMTDFQLVDAIRTLLQQKRYIIVFDDVLSVDAWDAIMYAFPDCNSGSRIIFTTRSSNVAASLEITNRVYHLQLLTQSEAWTLFCRKAFRAEHKGVCPVELEELSRGILRRCEELPLAIVAIGGMLSKKIKVGSEWRKVHDSLAAEFRNDNNLGSLQRMLLLSYNDLPHYLKLCYLYLSVFPEDYLIRRTNLVRLWVVERIVKEKQGLTMEEAAEDYFNELVSRSMIQVVEVDFSYRVKTCRLHDLMREIIQLKSKEESFVVIANERGIRTNDKVHRLSIHDNPKELSSGIRFPYLRSLLLFTPTDSVACFGHALFRDFKLLRVLELENLPLLSFPPELIGLIHLRYLSLRRTMITVLPESIRKLKNLEILDLKRSLVSSLPYGILELKNLRQLHVHGMRVPPGIGRLTSIQKLGTIEVNDDCELVKELGKLTQLRRLGVGSVRKEHGKDLCYSLDRMKHLTALFLVSMNRDELLCLDSVASPPTNLQCLYLNGCLLTLPKWIASLRYLSKLVFQFSKLQNDPLKALQDLPSLVVLEIREAYDGEELCCDARGFSRLKKLGLYQLKSLQSIKLAEGAMPGL

superfamily: SSF52540
145-400 SSF52540

VPVEPLRLASLYIDEADLVGIETPKSQLVAWLIEGEEKLTSISVVGMGVLGKTTLVKKVYDSQLIERSFDCYCWITVSKSFSHTELLRAALQGFLEATKEPAPEGMELMTDFQLVDAIRTLLQQKRYIIVFDDVLSVDAWDAIMYAFPDCNSGSRIIFTTRSSNVAASLEITNRVYHLQLLTQSEAWTLFCRKAFRAEHKGVCPVELEELSRGILRRCEELPLAIVAIGGMLSKKIKVGSEWRKVHDSLAAEFRND

HMMPfam: PF00931
IPR002182
166-456 NB-ARC,NBS
NB-ARC

ETPKSQLVAWLIEGEEKLTSISVVGMGVLGKTTLVKKVYDSQLIERSFDCYCWITVSKSFSHTELLRAALQGFLEATKEPAPEGMELMTDFQLVDAIRTLLQQKRYIIVFDDVLSVDAWDAIMYAFPDCNSGSRIIFTTRSSNVAASLEITNRVYHLQLLTQSEAWTLFCRKAFRAEHKGVCPVELEELSRGILRRCEELPLAIVAIGGMLSKKIKVGSEWRKVHDSLAAEFRNDNNLGSLQRMLLLSYNDLPHYLKLCYLYLSVFPEDYLIRRTNLVRLWVVERIVKEKQ

FPrintScan: PR00364
IPR000767
185-200 DISEASERSIST
Disease resistance protein

SISVVGMGVLGKTTLV

FPrintScan: PR00364
IPR000767
265-279 DISEASERSIST
Disease resistance protein

LLQQKRYIIVFDDVL

FPrintScan: PR00364
IPR000767
362-376 DISEASERSIST
Disease resistance protein

CEELPLAIVAIGGML

superfamily: SSF52058
492-831 SSF52058,LRR

RLHDLMREIIQLKSKEESFVVIANERGIRTNDKVHRLSIHDNPKELSSGIRFPYLRSLLLFTPTDSVACFGHALFRDFKLLRVLELENLPLLSFPPELIGLIHLRYLSLRRTMITVLPESIRKLKNLEILDLKRSLVSSLPYGILELKNLRQLHVHGMRVPPGIGRLTSIQKLGTIEVNDDCELVKELGKLTQLRRLGVGSVRKEHGKDLCYSLDRMKHLTALFLVSMNRDELLCLDSVASPPTNLQCLYLNGCLLTLPKWIASLRYLSKLVFQFSKLQNDPLKALQDLPSLVVLEIREAYDGEELCCDARGFSRLKKLGLYQLKSLQSIKLAEGAMPGL

Gene3D: G3DSA:3.80.10.10
566-685 G3DSA:3.80.10.10

FRDFKLLRVLELENLPLLSFPPELIGLIHLRYLSLRRTMITVLPESIRKLKNLEILDLKRSLVSSLPYGILELKNLRQLHVHGMRVPPGIGRLTSIQKLGTIEVNDDCELVKELGKLTQL

HMMPfam: PF12799
595-631 LRR_4,Leucine Rich repeats (2 copies)

LRYLSLRRTMITVLPESIRKLKNLEILDLKRSLVSSL

FPrintScan: PR00364
IPR000767
613-629 DISEASERSIST
Disease resistance protein

RKLKNLEILDLKRSLVS

Gene3D: G3DSA:3.80.10.10
737-824 G3DSA:3.80.10.10

LQCLYLNGCLLTLPKWIASLRYLSKLVFQFSKLQNDPLKALQDLPSLVVLEIREAYDGEELCCDARGFSRLKKLGLYQLKSLQSIKLA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox