PRGDB00062214 (Disease resistance protein RPM1, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RPM1, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255580967 (XM_002531256)
Gene Class NL
Domain Type NBS, LRR
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RPM1, putative, mRNA.

DNA Sequence

ATGGGAAGCGTGCTGCGCCTCAAAAGAAAAGAGAGTGAATGGTTATCTGTCAAGGAAAGTGAGATTTGGGAGTTACCAAATGAAGGAAGCATGAATATTTTACTTGCTTTGAGGTTAAGTTATAATCACCTAGCACCGTATCTGAAACAATGTCTTGCATTTTGCTCACTATTTTCTAAAGATTACTGCATGGAGAAGGACAAAGGGATAGGATTATGGATGGCAAATGGCTTCATTACTTGCAAAGGAGAAATGGATTTGTACGATAAAGGCCATGAGACTTTTAGTGAATTAGTTTGGAGGTCGTTTTTCCAAGATGTGGAAGAGGATCTTTCAGGAAACACTGCATGTAAAATGCATGATTTTGTCCATGATCTTGCACAATCAATTATGAAAGACGAGTGCAAATTGATTGAACTCAACAAGGTCTCTGAAGTTCCAAAAAAGGCTCGGCATTTTAGCATTGTTAGGAATCCAGAGCAATCTTCTCCTCAGAGCAACAACCTCTTCAAGGATCAATCACTGCGTTCACTCCTTTGGATGGACTATTATTCCTCAAACCACCGGGTGCCTTCCTACTTGTCTGGCCAGAAGCATTTGAGAGTCTTGGATACCAGTGTCCTTTTGGATAAACTGCCGATGTCAAGTATCGGAAGTCTACCGGCATCAATAACCGCCCTCCAAAACTTGCAGACACTGCATCTTAAAAATTGCAATTATCTCTACAAATTACCAGAAGGTTTGAAGCACATGAAAAATCTCATGCAACCTGACATCACTGGATGTGATTCACTTAGATATATGCCTGCTGAAATGGGACAATTGACACGTCTGAGGAAGCTCAGCATCTTCGTTGTGGGCAACTACATTGGTTGTGGCATAGGAGAGCTGAAAGAATTGAATCTCGGGGGAGAGTTGTGCATTAAGAAGAAGAAAGAACTTCAGTCACTACAACTATCTTGGTCACCAGGAGGAAAAGACAATAGCAACCTATCAGAAAAGGTCATTGATAGCCTCCAACCCCATTCAAATCTAAAGAAGTTAGGCATATTTAAATATCCAGGTTCAAAATTTCCAAAATGGATGATGGAATTATTTCTACCAAATCTAGTGAAAATCGAGCTGTGTATTGGGAATGAGATATACGGGAATGGAGAAACTTCATTCCCATCATTGGAGAGCTTGAGTCTTGAATACGTGGGTGGTTTACAGGAATGGGCAATGGTCGGTGGTAGAGACATTTTTCCAGTCCTTGAGAGCTTAAGTGTCCGCTATTGTCTTCAATTGATGAATTACCGATTATGCCATTTCTCAAAAAATTAG


Protein sequences

Name Description Sequence
Disease resistance protein RPM1, putative Disease resistance protein RPM1, putative [Ricinus communis].

MGSVLRLKRKESEWLSVKESEIWELPNEGSMNILLALRLSYNHLAPYLKQCLAFCSLFSKDYCMEKDKGIGLWMANGFITCKGEMDLYDKGHETFSELVWRSFFQDVEEDLSGNTACKMHDFVHDLAQSIMKDECKLIELNKVSEVPKKARHFSIVRNPEQSSPQSNNLFKDQSLRSLLWMDYYSSNHRVPSYLSGQKHLRVLDTSVLLDKLPMSSIGSLPASITALQNLQTLHLKNCNYLYKLPEGLKHMKNLMQPDITGCDSLRYMPAEMGQLTRLRKLSIFVVGNYIGCGIGELKELNLGGELCIKKKKELQSLQLSWSPGGKDNSNLSEKVIDSLQPHSNLKKLGIFKYPGSKFPKWMMELFLPNLVKIELCIGNEIYGNGETSFPSLESLSLEYVGGLQEWAMVGGRDIFPVLESLSVRYCLQLMNYRLCHFSKN

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-81 NB-ARC,NBS
NB-ARC

MGSVLRLKRKESEWLSVKESEIWELPNEGSMNILLALRLSYNHLAPYLKQCLAFCSLFSKDYCMEKDKGIGLWMANGFITC

HMMPanther: PTHR23155:SF121
10-432 PTHR23155:SF121,SUBFAMILY NOT NAMED

KESEWLSVKESEIWELPNEGSMNILLALRLSYNHLAPYLKQCLAFCSLFSKDYCMEKDKGIGLWMANGFITCKGEMDLYDKGHETFSELVWRSFFQDVEEDLSGNTACKMHDFVHDLAQSIMKDECKLIELNKVSEVPKKARHFSIVRNPEQSSPQSNNLFKDQSLRSLLWMDYYSSNHRVPSYLSGQKHLRVLDTSVLLDKLPMSSIGSLPASITALQNLQTLHLKNCNYLYKLPEGLKHMKNLMQPDITGCDSLRYMPAEMGQLTRLRKLSIFVVGNYIGCGIGELKELNLGGELCIKKKKELQSLQLSWSPGGKDNSNLSEKVIDSLQPHSNLKKLGIFKYPGSKFPKWMMELFLPNLVKIELCIGNEIYGNGETSFPSLESLSLEYVGGLQEWAMVGGRDIFPVLESLSVRYCLQLMNY

HMMPanther: PTHR23155
10-432 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KESEWLSVKESEIWELPNEGSMNILLALRLSYNHLAPYLKQCLAFCSLFSKDYCMEKDKGIGLWMANGFITCKGEMDLYDKGHETFSELVWRSFFQDVEEDLSGNTACKMHDFVHDLAQSIMKDECKLIELNKVSEVPKKARHFSIVRNPEQSSPQSNNLFKDQSLRSLLWMDYYSSNHRVPSYLSGQKHLRVLDTSVLLDKLPMSSIGSLPASITALQNLQTLHLKNCNYLYKLPEGLKHMKNLMQPDITGCDSLRYMPAEMGQLTRLRKLSIFVVGNYIGCGIGELKELNLGGELCIKKKKELQSLQLSWSPGGKDNSNLSEKVIDSLQPHSNLKKLGIFKYPGSKFPKWMMELFLPNLVKIELCIGNEIYGNGETSFPSLESLSLEYVGGLQEWAMVGGRDIFPVLESLSVRYCLQLMNY

superfamily: SSF52058
118-433 SSF52058,LRR

KMHDFVHDLAQSIMKDECKLIELNKVSEVPKKARHFSIVRNPEQSSPQSNNLFKDQSLRSLLWMDYYSSNHRVPSYLSGQKHLRVLDTSVLLDKLPMSSIGSLPASITALQNLQTLHLKNCNYLYKLPEGLKHMKNLMQPDITGCDSLRYMPAEMGQLTRLRKLSIFVVGNYIGCGIGELKELNLGGELCIKKKKELQSLQLSWSPGGKDNSNLSEKVIDSLQPHSNLKKLGIFKYPGSKFPKWMMELFLPNLVKIELCIGNEIYGNGETSFPSLESLSLEYVGGLQEWAMVGGRDIFPVLESLSVRYCLQLMNYR

Gene3D: G3DSA:3.80.10.10
124-292 G3DSA:3.80.10.10

HDLAQSIMKDECKLIELNKVSEVPKKARHFSIVRNPEQSSPQSNNLFKDQSLRSLLWMDYYSSNHRVPSYLSGQKHLRVLDTSVLLDKLPMSSIGSLPASITALQNLQTLHLKNCNYLYKLPEGLKHMKNLMQPDITGCDSLRYMPAEMGQLTRLRKLSIFVVGNYIGC

Gene3D: G3DSA:3.80.10.10
306-426 G3DSA:3.80.10.10

LCIKKKKELQSLQLSWSPGGKDNSNLSEKVIDSLQPHSNLKKLGIFKYPGSKFPKWMMELFLPNLVKIELCIGNEIYGNGETSFPSLESLSLEYVGGLQEWAMVGGRDIFPVLESLSVRYC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox