PRGDB00062215 (Disease resistance protein RPM1, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RPM1, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255578635 (XM_002530133)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RPM1, putative, mRNA.

DNA Sequence

ATGGGAACGGTGGCAAAGGGGCTAGAGATAGGAGGAAAAGCTGAAGCATTAATGGATAACGTTGTGAGCGAGGACGATATGCAAACTCTCAGACGTAAGTTGCAACAATTGGAAAGCATTAAAGCTGATAAAGTGGAAGAATTACAAACAGCAGTGTTGCAGACTGCCAAGAAACCGATGAATGAACTTCAAATTTGGTCGAGGAATATATCAATGGCGAAAGTTAAAGTTCAGAACATGGAACAAGAAGTGAAACAAGGTGGGTTGAGTGGCAAACTATTAGGAAAGCGTGTAAAGAAAATGATGGAAGAAATGAAAGAGCTAATTGATCAGAATGCTAGATTTCAAGGACGTCTTGTAAGTGATGCAGGTGATAATAGTAGAGTTGCATTGTTGGCCCCAAAATTAGTTTGCCAAGCATTTGAAATAAACAAGGAGAAGATATGGCAGTATTTAGAGGAGGGTGAGGGCTTTTGCATTGGTATTTGGGGGATGGGAGGAGTGGGAAAAACCACGCTTTTGACATATATCTACAATGAGCTCCTCCGAAAACAGAAGAATGTTTATTGGATCACTGTATCACAAGACTTCAGTGTAAGGAAATTGCAGAATCATATTGCCAAAGCTATTGATCGTGATATTTCCATAGAAGATGACGAGAAGAAAAGGGCTGCGTTGCTCTGGAATGCACTGAGTAATAAACAAAAATTTGTTCTCATTCTAGATGATTTGTGGGAAAATTTTTCTCTAGAGAATGTGGGTATACCTATCTCCAAAGAAAACGGATGCAAGTTGATCTTTACAAGTCGTTCATTAGAAGTTTGTAACAAGATGGATTGCCGGAGGAAGATCAAAGTGGAGCCTCTTTCTGAAGAAGAAGCTTGGAATTTGTTCCAAGAGAAACTTGGTGAAAAAATCCTCGATGATGGTAGCGAGATCGCAAAATCTATTGCAAAGAGATGTGCTGGTTTACCTCTTGGAATTATAACTATGGCTAGCAGCATGAAGGGAGTGGATGATTTAAGTGAATGGAGGAACACATTGAGGATTTTGGAAGATTCAAAAGTTGGAGAAGGTGATAACGAATTCGAGGTATTCCGAATACTGAAATTTAGCTACGATCGCTTAGGAAATTCAGCATTGCAAAAGTGCTACTTATATTGTGCATTATATCCCGAAGATCGTAAGATTAGAAGAGTGGAGCTGATAGACTATTTGATTGCTGAGGGAGTAATAGAAGAGAAAAGCAGACAAGCAGAATTTGACAAGGGACATACCATGCTCAATAAACTTGAAAAGGTTTGCTTGTTGGAACCTGTTTGTGACAATCAAAACTACAGATGTGTGAAGATGCATGACTTGATTAGGCATATGGCCATTCAATTAATGAAAGCAGACATAGTGGTTTGTGCAAAGTCAAGAGCACTAGATTGCAAAAGTTGGACAGCTGAACTTGTAAGAATTTCATCAATGTATAGTGGCATAAAAGAAATTCCTTCTAACCATTCACCACCATGTCCTAAAGTTTCTGTCCTATTGTTGCCCGGCAGTTATTTGCGATGGATTCCAGATCCTTTCTTTGAGCAATTGCATGGGCTCAAGATTCTTGATCTTTCAAATTCAGTATTTATTGAAGAATTGCCTACTTCGGTTTCTAACCTATGCAATCTTAGTACATTATTACTCAAACGTTGCTATGGGCTAAGGCGTGTGCCATCATTAGCAAAGCTCAAATCACTGAAAAAGTTGGATCTCAATTTTAGTGGAGTTGAAGAAGTGCCTCAAGACATGGAATTCCTCTCCAATCTTAAGCACCTAGGTCTTTTTGGAACGTTCATAAAGGAGTTCCCACCTGGCATATTACCGAAGCTTTCTCGTCTGCAAGTCCTCCTACTTGACCCAAGATTACCGGTTAAAGGAGTGGAAGTGGCATCCTTGAGAAATTTGGAAACTTTGTGCTGCTGTTTATGTGATTTTAACGAGTTCAACACATATTTCCAATCTTCAAAAGAGCGTCCTGGGCTAGCATTAAGAGACAAAGGCTTTTGGATTCATCAGCTGAAGGATTATTTTGTTTGGGTAGGAAAGGAATCTAATGACCTTCCAAAAATGAAAGACAAGATTTTTAATTTTGAGGAAGAACTAGAGTTTGTGCTTGGTAAGAGAGCAGTTTTGGGTAATTATAGTGTCATGAGAGGAGAAGGTTCTCCAAAGGAGTTCAAAATGATTGAAATTCAATCTTACCACACAGGATGGCTGTGCTTGGAAAATGAATCTCCATGGAAGAAGTTGGAGATTTTGAATTGTGTTGGAATTGAATCCTTGTTTCCATTGTGCTCCTCTTCTGTACTTCAAACCCTTGAAAAGATACAAATCAGGCATTCGATGAACTTACATGTACTCTTTAATATAGCTCCACCAGCTGCAACAGTACGTAATGGTACCTTTTCCCTTCTTAAAACATTTGAGATTTATGGTTGCCCAAGCATGAAGAAGCTGTTCCCTCATGGCTTGATGGCAAACCTTAAAAACCTGTCACAAATTTATGTTAGGTATTGTGAGAATATGGAGGAACTGATAGCAATAGAAGAAGAACAAGAAAGCCATCAGAGCAATGCCAGTAATTCATACACAATCCCAGAATTACGTTCTTTCAAGTTGGAACAATTACCAGAGCTGAAGAGCATTTGTAGCAGACAAATGATTTGCAATCATCTCCAATATCTTTGGATAATAAATTGTCCAAAGCTAAAACGAATACCAATATCTCTTGTCCTGCTGGAGAATCATCAAATAGCTCCTCTCCCTTCTCTTCAAGAAATCATAGTAAGCCCCCCAGAATGGTGGGAGATGGCCGAGGTGGATCATCCTAACGCTAAGAATATCCTCTCACCCCTCGTCTTATTCTAG


Protein sequences

Name Description Sequence
Disease resistance protein RPM1, putative Disease resistance protein RPM1, putative [Ricinus communis].

MGTVAKGLEIGGKAEALMDNVVSEDDMQTLRRKLQQLESIKADKVEELQTAVLQTAKKPMNELQIWSRNISMAKVKVQNMEQEVKQGGLSGKLLGKRVKKMMEEMKELIDQNARFQGRLVSDAGDNSRVALLAPKLVCQAFEINKEKIWQYLEEGEGFCIGIWGMGGVGKTTLLTYIYNELLRKQKNVYWITVSQDFSVRKLQNHIAKAIDRDISIEDDEKKRAALLWNALSNKQKFVLILDDLWENFSLENVGIPISKENGCKLIFTSRSLEVCNKMDCRRKIKVEPLSEEEAWNLFQEKLGEKILDDGSEIAKSIAKRCAGLPLGIITMASSMKGVDDLSEWRNTLRILEDSKVGEGDNEFEVFRILKFSYDRLGNSALQKCYLYCALYPEDRKIRRVELIDYLIAEGVIEEKSRQAEFDKGHTMLNKLEKVCLLEPVCDNQNYRCVKMHDLIRHMAIQLMKADIVVCAKSRALDCKSWTAELVRISSMYSGIKEIPSNHSPPCPKVSVLLLPGSYLRWIPDPFFEQLHGLKILDLSNSVFIEELPTSVSNLCNLSTLLLKRCYGLRRVPSLAKLKSLKKLDLNFSGVEEVPQDMEFLSNLKHLGLFGTFIKEFPPGILPKLSRLQVLLLDPRLPVKGVEVASLRNLETLCCCLCDFNEFNTYFQSSKERPGLALRDKGFWIHQLKDYFVWVGKESNDLPKMKDKIFNFEEELEFVLGKRAVLGNYSVMRGEGSPKEFKMIEIQSYHTGWLCLENESPWKKLEILNCVGIESLFPLCSSSVLQTLEKIQIRHSMNLHVLFNIAPPAATVRNGTFSLLKTFEIYGCPSMKKLFPHGLMANLKNLSQIYVRYCENMEELIAIEEEQESHQSNASNSYTIPELRSFKLEQLPELKSICSRQMICNHLQYLWIINCPKLKRIPISLVLLENHQIAPLPSLQEIIVSPPEWWEMAEVDHPNAKNILSPLVLF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF108
95-953 PTHR23155:SF108,SUBFAMILY NOT NAMED

GKRVKKMMEEMKELIDQNARFQGRLVSDAGDNSRVALLAPKLVCQAFEINKEKIWQYLEEGEGFCIGIWGMGGVGKTTLLTYIYNELLRKQKNVYWITVSQDFSVRKLQNHIAKAIDRDISIEDDEKKRAALLWNALSNKQKFVLILDDLWENFSLENVGIPISKENGCKLIFTSRSLEVCNKMDCRRKIKVEPLSEEEAWNLFQEKLGEKILDDGSEIAKSIAKRCAGLPLGIITMASSMKGVDDLSEWRNTLRILEDSKVGEGDNEFEVFRILKFSYDRLGNSALQKCYLYCALYPEDRKIRRVELIDYLIAEGVIEEKSRQAEFDKGHTMLNKLEKVCLLEPVCDNQNYRCVKMHDLIRHMAIQLMKADIVVCAKSRALDCKSWTAELVRISSMYSGIKEIPSNHSPPCPKVSVLLLPGSYLRWIPDPFFEQLHGLKILDLSNSVFIEELPTSVSNLCNLSTLLLKRCYGLRRVPSLAKLKSLKKLDLNFSGVEEVPQDMEFLSNLKHLGLFGTFIKEFPPGILPKLSRLQVLLLDPRLPVKGVEVASLRNLETLCCCLCDFNEFNTYFQSSKERPGLALRDKGFWIHQLKDYFVWVGKESNDLPKMKDKIFNFEEELEFVLGKRAVLGNYSVMRGEGSPKEFKMIEIQSYHTGWLCLENESPWKKLEILNCVGIESLFPLCSSSVLQTLEKIQIRHSMNLHVLFNIAPPAATVRNGTFSLLKTFEIYGCPSMKKLFPHGLMANLKNLSQIYVRYCENMEELIAIEEEQESHQSNASNSYTIPELRSFKLEQLPELKSICSRQMICNHLQYLWIINCPKLKRIPISLVLLENHQIAPLPSLQEIIVSPPEWWEMAE

HMMPanther: PTHR23155
95-953 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GKRVKKMMEEMKELIDQNARFQGRLVSDAGDNSRVALLAPKLVCQAFEINKEKIWQYLEEGEGFCIGIWGMGGVGKTTLLTYIYNELLRKQKNVYWITVSQDFSVRKLQNHIAKAIDRDISIEDDEKKRAALLWNALSNKQKFVLILDDLWENFSLENVGIPISKENGCKLIFTSRSLEVCNKMDCRRKIKVEPLSEEEAWNLFQEKLGEKILDDGSEIAKSIAKRCAGLPLGIITMASSMKGVDDLSEWRNTLRILEDSKVGEGDNEFEVFRILKFSYDRLGNSALQKCYLYCALYPEDRKIRRVELIDYLIAEGVIEEKSRQAEFDKGHTMLNKLEKVCLLEPVCDNQNYRCVKMHDLIRHMAIQLMKADIVVCAKSRALDCKSWTAELVRISSMYSGIKEIPSNHSPPCPKVSVLLLPGSYLRWIPDPFFEQLHGLKILDLSNSVFIEELPTSVSNLCNLSTLLLKRCYGLRRVPSLAKLKSLKKLDLNFSGVEEVPQDMEFLSNLKHLGLFGTFIKEFPPGILPKLSRLQVLLLDPRLPVKGVEVASLRNLETLCCCLCDFNEFNTYFQSSKERPGLALRDKGFWIHQLKDYFVWVGKESNDLPKMKDKIFNFEEELEFVLGKRAVLGNYSVMRGEGSPKEFKMIEIQSYHTGWLCLENESPWKKLEILNCVGIESLFPLCSSSVLQTLEKIQIRHSMNLHVLFNIAPPAATVRNGTFSLLKTFEIYGCPSMKKLFPHGLMANLKNLSQIYVRYCENMEELIAIEEEQESHQSNASNSYTIPELRSFKLEQLPELKSICSRQMICNHLQYLWIINCPKLKRIPISLVLLENHQIAPLPSLQEIIVSPPEWWEMAE

HMMPfam: PF00931
IPR002182
144-415 NB-ARC,NBS
NB-ARC

NKEKIWQYLEEGEGFCIGIWGMGGVGKTTLLTYIYNELLRKQKNVYWITVSQDFSVRKLQNHIAKAIDRDISIEDDEKKRAALLWNALSNKQKFVLILDDLWENFSLENVGIPISKENGCKLIFTSRSLEVCNKMDCRRKIKVEPLSEEEAWNLFQEKLGEKILDDGSEIAKSIAKRCAGLPLGIITMASSMKGVDDLSEWRNTLRILEDSKVGEGDNEFEVFRILKFSYDRLGNSALQKCYLYCALYPEDRKIRRVELIDYLIAEGVIEEK

superfamily: SSF52540
145-358 SSF52540

KEKIWQYLEEGEGFCIGIWGMGGVGKTTLLTYIYNELLRKQKNVYWITVSQDFSVRKLQNHIAKAIDRDISIEDDEKKRAALLWNALSNKQKFVLILDDLWENFSLENVGIPISKENGCKLIFTSRSLEVCNKMDCRRKIKVEPLSEEEAWNLFQEKLGEKILDDGSEIAKSIAKRCAGLPLGIITMASSMKGVDDLSEWRNTLRILEDSKVGE

Gene3D: G3DSA:3.40.50.300
153-281 G3DSA:3.40.50.300

EEGEGFCIGIWGMGGVGKTTLLTYIYNELLRKQKNVYWITVSQDFSVRKLQNHIAKAIDRDISIEDDEKKRAALLWNALSNKQKFVLILDDLWENFSLENVGIPISKENGCKLIFTSRSLEVCNKMDCR

FPrintScan: PR00364
IPR000767
159-174 DISEASERSIST
Disease resistance protein

CIGIWGMGGVGKTTLL

FPrintScan: PR00364
IPR000767
231-245 DISEASERSIST
Disease resistance protein

LSNKQKFVLILDDLW

FPrintScan: PR00364
IPR000767
321-335 DISEASERSIST
Disease resistance protein

CAGLPLGIITMASSM

superfamily: SSF52058
434-944 SSF52058,LRR

VCLLEPVCDNQNYRCVKMHDLIRHMAIQLMKADIVVCAKSRALDCKSWTAELVRISSMYSGIKEIPSNHSPPCPKVSVLLLPGSYLRWIPDPFFEQLHGLKILDLSNSVFIEELPTSVSNLCNLSTLLLKRCYGLRRVPSLAKLKSLKKLDLNFSGVEEVPQDMEFLSNLKHLGLFGTFIKEFPPGILPKLSRLQVLLLDPRLPVKGVEVASLRNLETLCCCLCDFNEFNTYFQSSKERPGLALRDKGFWIHQLKDYFVWVGKESNDLPKMKDKIFNFEEELEFVLGKRAVLGNYSVMRGEGSPKEFKMIEIQSYHTGWLCLENESPWKKLEILNCVGIESLFPLCSSSVLQTLEKIQIRHSMNLHVLFNIAPPAATVRNGTFSLLKTFEIYGCPSMKKLFPHGLMANLKNLSQIYVRYCENMEELIAIEEEQESHQSNASNSYTIPELRSFKLEQLPELKSICSRQMICNHLQYLWIINCPKLKRIPISLVLLENHQIAPLPSLQEIIVS

Gene3D: G3DSA:3.80.10.10
477-664 G3DSA:3.80.10.10

DCKSWTAELVRISSMYSGIKEIPSNHSPPCPKVSVLLLPGSYLRWIPDPFFEQLHGLKILDLSNSVFIEELPTSVSNLCNLSTLLLKRCYGLRRVPSLAKLKSLKKLDLNFSGVEEVPQDMEFLSNLKHLGLFGTFIKEFPPGILPKLSRLQVLLLDPRLPVKGVEVASLRNLETLCCCLCDFNEFNT

FPrintScan: PR00364
IPR000767
528-544 DISEASERSIST
Disease resistance protein

EQLHGLKILDLSNSVFI

Gene3D: G3DSA:3.80.10.10
837-929 G3DSA:3.80.10.10

GLMANLKNLSQIYVRYCENMEELIAIEEEQESHQSNASNSYTIPELRSFKLEQLPELKSICSRQMICNHLQYLWIINCPKLKRIPISLVLLEN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox