PRGDB00062216 (Disease resistance protein RGA2, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RGA2, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255577307 (XM_002529489)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RGA2, putative, mRNA.

DNA Sequence

ATGGAGATCGCGCTTGCCGTTGGAGGTGCTCTTCTTTCACCTGCTTTTCAGGTGTTGCTCGACAAGTTGACGTCCATGGACTTGCTCAACTACGCACGCCAAGGTCATGTCCTGGACGAACTCAAGAAATGGGATAGATTGCTGAACAAAATTTATGCTTTTCTTGATGATGCAGAGGAGAAGCAGATGACAAATCAGTCGGTGAAAGTCTGGGTCAGCGAGCTTAGACACTTAGCTTATGATGTTGAAGACATACTTGATGAGTTTGACACCGAAGCTCGGCGACGCAGGCTCCTGGCGGAAGCCACACCCAGTACAAGTAATTTGAGGAAATTCATTCCTGCTTGTTGTGTTGGGATGATTCCAAGAACTGTTAAGTTCAACGCTGAGGTGATTTCAATGATGGAGAAAATTACTATTAGGTTAGAGGATATCATAAGAGAAAAGGATGTCCTGCATTTGGAAGAGGGTACACGAGGAAGGATCAGCCGAGTAAGAGAAAGATCTGCCACAACCTGTTTGGTGAATGAAGCTCAGGTTTATGGCAGGGAGGAAGACAAAGAGGCAGTACTTAGACTGCTGAAAGGAAAAACTAGAAGCTCGGAAATCTCTGTCATTCCAATAGTTGGCATGGGGGGCATCGGTAAAACCACCCTTGCTCAGCTTGTCTTCAATGATACTACGCTGGAGTTTGACTTCAAAGCTTGGGTTTCGGTTGGTGAAGATTTCAACGTTTCCAAGATAACCAAAATAATCCTTCAATCAAAAGATTGTGATAGTGAAGATCTAAATTCACTCCAAGTGAGACTGAAGGAGAAGCTGTCCAGAAACAAGTTTCTAATCGTCCTGGATGATGTTTGGACAGAAAATTATGATGACTGGACACTGTTTCGAGGTCCTTTTGAAGCAGGGGCACCAGGAAGCAGGATTATCATTACAACTCGGAGTGAAGGTGTGTCATCAAAGATGGGTACGACTCCAGCATATTATCTGCAGAAGTTGTCATTTGATGACTGCTTGTCAATATTTGTTTATCACGCTTTGGGAACAAGAAAGTTTGATGAATACTGGGACTTGGAAGAAATAGGTGCAGAAATTGCCAAAAAGTGTCAAGGATTGCCTTTGGCAGCTAAGACACTAGGTGGGCTTTTGAGGGGTAAACCGAATTTGAATGCTTGGATAGAAGTGTTGGAAAGTAAAATCTGGGATCTACCTGAGGATAATGGTATTCTTCCAGCCCTAAGGCTGAGCTATCATCACCTTCCTTCCCACTTGAAACGATGCTTCGCGCATTGTGCAATATTTCCTAAAGATTACAAATTTCATTGGCATGACTTGGTTCTTTTATGGATGGCTGAAGGCTTATTGCAGCAGTCAAAAACAAAGAAGAAAATGGAGGACATAGGGCTGGACTATTTCAATCAATTGTTATCAAGATCATTATTTGAAGAGTGTAGTGGGGGATTTTTTGGGATGCATAATCTCATAACTGATTTAGCTCATTCTGTAGCAGGAGAAACATTCATTGACTTAGTGGATGATTTGGGTGGTAGCCAACTATATGCAGATTTTGATAAGGTTCGCAATTTGACTTACACTAAGTGGTTAGAGATCTCGCAGAGATTAGAAGTGCTGTGTAAACTGAAGCGCTTAAGAACATTAATTGTACTTGATCTATACCGTGAAAAGATAGATGTGGAGTTGAACATCTTGCTACCTGAACTAAAGTGCCTCAGAGTGCTATCTCTTGAACATGCTAGCATTACCCAATTGCCAAACTCAATCGGTAGATTGAACCATTTGCGATTTCTGAACTTGGCGTATGCAGGCATCAAGTGGTTACCTGAATCAGTATGTGCACTTCTCAACTTGCATATGCTGGTATTGAATTGGTGCTTCAATTTGACAACATTGCCTCAAGGAATCAAATATTTAATTAATCTGCACTTTCTTGAAATTACGGAGACAGCGAGATTACAAGAAATGCCAGTAGGGGTAGGTAACCTAACCTGTCTTCAGGTATTGACGAAGTTTATTGTGGGAAAAGGTGATGGTCTGAGGCTACGGGAGTTAAAGGACTTGTTGTATCTTCAGGGGGAACTTTCTTTACAAGGGCTTCACAATGTGGTGGATATTGAAGATGCGAAGGTTGCTAATTTGAAGGATAAGCATGGCCTTAATACGTTAGAGATGCGTTGGAGGGACGACTTCAATGATTCACGAAGTGAAAGGGAAGAAACACTGGTGCTTGACTCGCTGCAACCTCCGACACATCTGGAAATTCTTACAATTGCTTTCTTTGGTGGCACAAGCTTCCCAATATGGCTGGGGGAGCACTCATTTGTGAAACTGGTGCAGGTGGATCTTATCAGCTGCATGAAAAGCATGTCATTGCCATCGCTTGGTCGACTACCCTCACTTAGAAGGTTATCCATAAAAAACGCAGAAAGTGTTAGAACTGTTGGCGTGGAGTTTTATGGAGATGACTTGCGTTCTTGGAAGCCTTTTCAGTCTCTTGAAAGTCTGCAGTTCCAGAACATGACAGATTGGGAGCACTGGACTTGCAGTGCCATAAATTTCCCTCGTCTCCATCACCTTGAGCTACGGAATTGTCCCAAATTGATGGGAGAATTACCTAAACATCTCCCATCCCTTGAAAATCTTCATATTGTTGCATGCCCGCAGTTGAAAGATTCACTTACAAGTCTACCATCTCTTTCTACACTAGAAATAGAAAATTGTAGTCAGGTAGTTCTTGGAAAAGTGTTTAATATTCAGCATATCACATCCTTGCAGTTGTGTGGAATTTCAGGGCTGGCTTGCTTAGAGAAAAGGCTTATGTGGGAAGTGAAAGCACTCAAAGTTCTAAAGGTAGAAGATTGCTCTGACCTATCAGTTCTATGGAAAGATGGATGTCGGACACAGGAGCTGAGTTGTCTGAAGCGTGTACTGATTACAAAATGTCTAAACCTTAAAGTCCTCGCCAGTGGTGATCAAGGTTTCCCTTGCAATCTCGAGTTTTTGATATTGGATGAGTGTAAGAACCTGGAGAAACTGACAAACGAGCTATACAACCTTGCATCTTTTGCACATTTAAGAATCGGAAATTGTCCAAAACTTAAATTCCCAGCAACTGGCTTACCACAAACATTAACGTACCTTAAGTTTGAAGATTCTCATAAGCAAGGTTATCTTATGTATGGAGATGAACTAAATGATCCCGGACACATATATTGGTATAGTTCTGGGATATCTACATACGAACCCTCTCAAGAAGAAGGAAAGATGCTCATCTATATTTCAGATTTATTGCAATTGGAGTCGCTCTTGCAGAGCTTGGTTTGCAGTAATATCAAACACATCTCTATTCCAGTCTGTCAAAATGTCAAATGCTTTACAGATTTCAAGCACAGCCTCCTTCATCTCACAGGACTGACCATAACCAGTTGTTGTCGTAAGGAAATGCCTACTGCAATGTCAGAGTGGGGACTATCTAGTCTCTCTTCTCTTCAACGTCTTGAGATTAATAGGGTAGAAATGGTTTCATTTCCTGATGATGACGGCCGCCTACTTCCCACATCCTTGAAGCATCTCCTTATCAGCGAAGTTGACAATCTGCAGTCCATATCCAAGGGGATCCTAAATCTCACCTCCCTTAAAATACTGAATATCCATTCCTGCAAAAGTATTTCATCCTTGCCAAAGGAGGGCCTGCCAGTTTCACTTCAAACACTAGACATATCTTACTGTCCTTCCTTAGAGCATTACTTAGAAGAGAAAGGCAACTATTGGTCCATCATTTCCCAGATTCCAGAAAGACGTATGCTTTTTGGGGAAAATCCTTTCGTGTGTGTAATTCAGTAA


Protein sequences

Name Description Sequence
Disease resistance protein RGA2, putative Disease resistance protein RGA2, putative [Ricinus communis].

MEIALAVGGALLSPAFQVLLDKLTSMDLLNYARQGHVLDELKKWDRLLNKIYAFLDDAEEKQMTNQSVKVWVSELRHLAYDVEDILDEFDTEARRRRLLAEATPSTSNLRKFIPACCVGMIPRTVKFNAEVISMMEKITIRLEDIIREKDVLHLEEGTRGRISRVRERSATTCLVNEAQVYGREEDKEAVLRLLKGKTRSSEISVIPIVGMGGIGKTTLAQLVFNDTTLEFDFKAWVSVGEDFNVSKITKIILQSKDCDSEDLNSLQVRLKEKLSRNKFLIVLDDVWTENYDDWTLFRGPFEAGAPGSRIIITTRSEGVSSKMGTTPAYYLQKLSFDDCLSIFVYHALGTRKFDEYWDLEEIGAEIAKKCQGLPLAAKTLGGLLRGKPNLNAWIEVLESKIWDLPEDNGILPALRLSYHHLPSHLKRCFAHCAIFPKDYKFHWHDLVLLWMAEGLLQQSKTKKKMEDIGLDYFNQLLSRSLFEECSGGFFGMHNLITDLAHSVAGETFIDLVDDLGGSQLYADFDKVRNLTYTKWLEISQRLEVLCKLKRLRTLIVLDLYREKIDVELNILLPELKCLRVLSLEHASITQLPNSIGRLNHLRFLNLAYAGIKWLPESVCALLNLHMLVLNWCFNLTTLPQGIKYLINLHFLEITETARLQEMPVGVGNLTCLQVLTKFIVGKGDGLRLRELKDLLYLQGELSLQGLHNVVDIEDAKVANLKDKHGLNTLEMRWRDDFNDSRSEREETLVLDSLQPPTHLEILTIAFFGGTSFPIWLGEHSFVKLVQVDLISCMKSMSLPSLGRLPSLRRLSIKNAESVRTVGVEFYGDDLRSWKPFQSLESLQFQNMTDWEHWTCSAINFPRLHHLELRNCPKLMGELPKHLPSLENLHIVACPQLKDSLTSLPSLSTLEIENCSQVVLGKVFNIQHITSLQLCGISGLACLEKRLMWEVKALKVLKVEDCSDLSVLWKDGCRTQELSCLKRVLITKCLNLKVLASGDQGFPCNLEFLILDECKNLEKLTNELYNLASFAHLRIGNCPKLKFPATGLPQTLTYLKFEDSHKQGYLMYGDELNDPGHIYWYSSGISTYEPSQEEGKMLIYISDLLQLESLLQSLVCSNIKHISIPVCQNVKCFTDFKHSLLHLTGLTITSCCRKEMPTAMSEWGLSSLSSLQRLEINRVEMVSFPDDDGRLLPTSLKHLLISEVDNLQSISKGILNLTSLKILNIHSCKSISSLPKEGLPVSLQTLDISYCPSLEHYLEEKGNYWSIISQIPERRMLFGENPFVCVIQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF236
51-898 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

IYAFLDDAEEKQMTNQSVKVWVSELRHLAYDVEDILDEFDTEARRRRLLAEATPSTSNLRKFIPACCVGMIPRTVKFNAEVISMMEKITIRLEDIIREKDVLHLEEGTRGRISRVRERSATTCLVNEAQVYGREEDKEAVLRLLKGKTRSSEISVIPIVGMGGIGKTTLAQLVFNDTTLEFDFKAWVSVGEDFNVSKITKIILQSKDCDSEDLNSLQVRLKEKLSRNKFLIVLDDVWTENYDDWTLFRGPFEAGAPGSRIIITTRSEGVSSKMGTTPAYYLQKLSFDDCLSIFVYHALGTRKFDEYWDLEEIGAEIAKKCQGLPLAAKTLGGLLRGKPNLNAWIEVLESKIWDLPEDNGILPALRLSYHHLPSHLKRCFAHCAIFPKDYKFHWHDLVLLWMAEGLLQQSKTKKKMEDIGLDYFNQLLSRSLFEECSGGFFGMHNLITDLAHSVAGETFIDLVDDLGGSQLYADFDKVRNLTYTKWLEISQRLEVLCKLKRLRTLIVLDLYREKIDVELNILLPELKCLRVLSLEHASITQLPNSIGRLNHLRFLNLAYAGIKWLPESVCALLNLHMLVLNWCFNLTTLPQGIKYLINLHFLEITETARLQEMPVGVGNLTCLQVLTKFIVGKGDGLRLRELKDLLYLQGELSLQGLHNVVDIEDAKVANLKDKHGLNTLEMRWRDDFNDSRSEREETLVLDSLQPPTHLEILTIAFFGGTSFPIWLGEHSFVKLVQVDLISCMKSMSLPSLGRLPSLRRLSIKNAESVRTVGVEFYGDDLRSWKPFQSLESLQFQNMTDWEHWTCSAINFPRLHHLELRNCPKLMGELPKHLPSLENLHIVACPQLKD

HMMPanther: PTHR23155
51-898 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IYAFLDDAEEKQMTNQSVKVWVSELRHLAYDVEDILDEFDTEARRRRLLAEATPSTSNLRKFIPACCVGMIPRTVKFNAEVISMMEKITIRLEDIIREKDVLHLEEGTRGRISRVRERSATTCLVNEAQVYGREEDKEAVLRLLKGKTRSSEISVIPIVGMGGIGKTTLAQLVFNDTTLEFDFKAWVSVGEDFNVSKITKIILQSKDCDSEDLNSLQVRLKEKLSRNKFLIVLDDVWTENYDDWTLFRGPFEAGAPGSRIIITTRSEGVSSKMGTTPAYYLQKLSFDDCLSIFVYHALGTRKFDEYWDLEEIGAEIAKKCQGLPLAAKTLGGLLRGKPNLNAWIEVLESKIWDLPEDNGILPALRLSYHHLPSHLKRCFAHCAIFPKDYKFHWHDLVLLWMAEGLLQQSKTKKKMEDIGLDYFNQLLSRSLFEECSGGFFGMHNLITDLAHSVAGETFIDLVDDLGGSQLYADFDKVRNLTYTKWLEISQRLEVLCKLKRLRTLIVLDLYREKIDVELNILLPELKCLRVLSLEHASITQLPNSIGRLNHLRFLNLAYAGIKWLPESVCALLNLHMLVLNWCFNLTTLPQGIKYLINLHFLEITETARLQEMPVGVGNLTCLQVLTKFIVGKGDGLRLRELKDLLYLQGELSLQGLHNVVDIEDAKVANLKDKHGLNTLEMRWRDDFNDSRSEREETLVLDSLQPPTHLEILTIAFFGGTSFPIWLGEHSFVKLVQVDLISCMKSMSLPSLGRLPSLRRLSIKNAESVRTVGVEFYGDDLRSWKPFQSLESLQFQNMTDWEHWTCSAINFPRLHHLELRNCPKLMGELPKHLPSLENLHIVACPQLKD

superfamily: SSF52540
163-407 SSF52540

SRVRERSATTCLVNEAQVYGREEDKEAVLRLLKGKTRSSEISVIPIVGMGGIGKTTLAQLVFNDTTLEFDFKAWVSVGEDFNVSKITKIILQSKDCDSEDLNSLQVRLKEKLSRNKFLIVLDDVWTENYDDWTLFRGPFEAGAPGSRIIITTRSEGVSSKMGTTPAYYLQKLSFDDCLSIFVYHALGTRKFDEYWDLEEIGAEIAKKCQGLPLAAKTLGGLLRGKPNLNAWIEVLESKIWDLPED

Gene3D: G3DSA:3.40.50.300
178-290 G3DSA:3.40.50.300

AQVYGREEDKEAVLRLLKGKTRSSEISVIPIVGMGGIGKTTLAQLVFNDTTLEFDFKAWVSVGEDFNVSKITKIILQSKDCDSEDLNSLQVRLKEKLSRNKFLIVLDDVWTEN

HMMPfam: PF00931
IPR002182
184-460 NB-ARC,NBS
NB-ARC

EEDKEAVLRLLKGKTRSSEISVIPIVGMGGIGKTTLAQLVFNDTTLEFDFKAWVSVGEDFNVSKITKIILQSKDCDSEDLNSLQVRLKEKLSRNKFLIVLDDVWTENYDDWTLFRGPFEAGAPGSRIIITTRSEGVSSKMGTTPAYYLQKLSFDDCLSIFVYHALGTRKFDEYWDLEEIGAEIAKKCQGLPLAAKTLGGLLRGKPNLNAWIEVLESKIWDLPEDNGILPALRLSYHHLPSHLKRCFAHCAIFPKDYKFHWHDLVLLWMAEGLLQQSK

FPrintScan: PR00364
IPR000767
205-220 DISEASERSIST
Disease resistance protein

VIPIVGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
273-287 DISEASERSIST
Disease resistance protein

KLSRNKFLIVLDDVW

FPrintScan: PR00364
IPR000767
370-384 DISEASERSIST
Disease resistance protein

CQGLPLAAKTLGGLL

superfamily: SSF52058
491-962 SSF52058,LRR

GMHNLITDLAHSVAGETFIDLVDDLGGSQLYADFDKVRNLTYTKWLEISQRLEVLCKLKRLRTLIVLDLYREKIDVELNILLPELKCLRVLSLEHASITQLPNSIGRLNHLRFLNLAYAGIKWLPESVCALLNLHMLVLNWCFNLTTLPQGIKYLINLHFLEITETARLQEMPVGVGNLTCLQVLTKFIVGKGDGLRLRELKDLLYLQGELSLQGLHNVVDIEDAKVANLKDKHGLNTLEMRWRDDFNDSRSEREETLVLDSLQPPTHLEILTIAFFGGTSFPIWLGEHSFVKLVQVDLISCMKSMSLPSLGRLPSLRRLSIKNAESVRTVGVEFYGDDLRSWKPFQSLESLQFQNMTDWEHWTCSAINFPRLHHLELRNCPKLMGELPKHLPSLENLHIVACPQLKDSLTSLPSLSTLEIENCSQVVLGKVFNIQHITSLQLCGISGLACLEKRLMWEVKALKVLKVEDCS

Gene3D: G3DSA:3.80.10.10
542-675 G3DSA:3.80.10.10

LEVLCKLKRLRTLIVLDLYREKIDVELNILLPELKCLRVLSLEHASITQLPNSIGRLNHLRFLNLAYAGIKWLPESVCALLNLHMLVLNWCFNLTTLPQGIKYLINLHFLEITETARLQEMPVGVGNLTCLQVL

Gene3D: G3DSA:3.80.10.10
720-867 G3DSA:3.80.10.10

LKDKHGLNTLEMRWRDDFNDSRSEREETLVLDSLQPPTHLEILTIAFFGGTSFPIWLGEHSFVKLVQVDLISCMKSMSLPSLGRLPSLRRLSIKNAESVRTVGVEFYGDDLRSWKPFQSLESLQFQNMTDWEHWTCSAINFPRLHHLE

Gene3D: G3DSA:3.80.10.10
868-1059 G3DSA:3.80.10.10

LRNCPKLMGELPKHLPSLENLHIVACPQLKDSLTSLPSLSTLEIENCSQVVLGKVFNIQHITSLQLCGISGLACLEKRLMWEVKALKVLKVEDCSDLSVLWKDGCRTQELSCLKRVLITKCLNLKVLASGDQGFPCNLEFLILDECKNLEKLTNELYNLASFAHLRIGNCPKLKFPATGLPQTLTYLKFEDS

superfamily: SSF52058
895-1273 SSF52058,LRR

QLKDSLTSLPSLSTLEIENCSQVVLGKVFNIQHITSLQLCGISGLACLEKRLMWEVKALKVLKVEDCSDLSVLWKDGCRTQELSCLKRVLITKCLNLKVLASGDQGFPCNLEFLILDECKNLEKLTNELYNLASFAHLRIGNCPKLKFPATGLPQTLTYLKFEDSHKQGYLMYGDELNDPGHIYWYSSGISTYEPSQEEGKMLIYISDLLQLESLLQSLVCSNIKHISIPVCQNVKCFTDFKHSLLHLTGLTITSCCRKEMPTAMSEWGLSSLSSLQRLEINRVEMVSFPDDDGRLLPTSLKHLLISEVDNLQSISKGILNLTSLKILNIHSCKSISSLPKEGLPVSLQTLDISYCPSLEHYLEEKGNYWSIISQIPER

FPrintScan: PR00364
IPR000767
901-917 DISEASERSIST
Disease resistance protein

TSLPSLSTLEIENCSQV

Gene3D: G3DSA:3.80.10.10
1102-1254 G3DSA:3.80.10.10

DLLQLESLLQSLVCSNIKHISIPVCQNVKCFTDFKHSLLHLTGLTITSCCRKEMPTAMSEWGLSSLSSLQRLEINRVEMVSFPDDDGRLLPTSLKHLLISEVDNLQSISKGILNLTSLKILNIHSCKSISSLPKEGLPVSLQTLDISYCPSLE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox