PRGDB00062221 (Disease resistance protein RPH8A, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RPH8A, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255574443 (XM_002528088)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RPH8A, putative, mRNA.

DNA Sequence

ATGGCAGCAGCAGATGGTGCAGTGAGTTTCCTTCTCCAAAAATTCGATACCCTCATAGCTAGAGAATGGAACCTTTTCAGTGGGATAAAAACTGAAGTTGGTGGATTGAAAAATGAGTTTGAGATGATGAGAGCAATCCTGAAAGAAGCTGATGATGCAAAAAGAGAAAGCAACGAACAAGTGAGAGTTTGGATAAAACAAGTGAGGGATTTAGCTTATGACATAGAGGATATTCTTGACATGTATGCTTTCCACACTTGTCAACATTCTTCTTCTTCTTCTTCTTCTTCCTCTAGCATTTACCCTAAATTCCTTCGATGGAAAAGAAGCCGTTCAATTTCCGTTTTGGTTCAAGATATGAAGAATAAACTCTCAGGAGTCAAAGAAATGAGAGAAAGGTACCAACTTATTGCAAGTTCACCTCAAGCCTCAAGTTCATGTCAAGAAAATTACAAACATTTTCAGTATCCTAGAGTGGCTTCTCTGTACACTGATGAAGCTGACATTGTAGGCATTGAAGAACCAAGGGATAAATTGATGGCATGGGCAGTTAATGGAGAATCTAGTCTGAAGGTTGTCTTCTTGGTTGGAATGGCTGGATTGGGAAAGACACTTGTCGCCAAAAAGGTATATGAAGGAACAAAGAAAAGCTTTGATTGTTGTGCCTGGATTCCAATTTCAGTGTCTCAAAAGAAAGAGGAGTTGCTGTGGACAATACTGAAGCGGCTTTTTGAATCTAATGACGAGCCAATACCTCGAGAGTATTACACCATCAGTATAGTTCAATTAATGGACAAAATGAGAAGTTTTCTTCAACACAGAAGGTACATAGTTGTTTTTGATGATTTATGGGACAAAGATGTATGGGAATTCATAAAATATGCTTTGCCAAACCGAATCCATAGTCGAGTGATTATCACTACGCGGAGAGGTGATATTGCTCACTTTTATCATCATGATTCTGTTGGTGTCTATAACCTTCAGCCTTTGCCTCTGGAAAAGGCTCAAGAATTGTTCTACAACAAGACTTTCCAATCCAGTGGTGTATGCCCTTCAGGTCTGATTGAGTGGTCAGGGAAGTTCCTCAAGCAGTGTGAAGGATTGCCTCTCGGAATTGTTGCTATAAGCAATCTTTTGGCGAATACTGAGAAAACAGCAGATGCATGGAGGAAACTACATGACAGCCTTGGATCAGAACTGGACAGCAATGGTCATCTTTCAAGCGTCACGAATGTAATATCGCCAAGTTATGATGATCTGCCATATTCTCTCAAGTATTGTTTATTGTACTTCAGTATCTTTCCTGAAGAATACTCAATTAAGCGAAGAAAATTGATTCGTTTGTGGATATCTGAGGGGCTTGTCAAAGAAGTGATGGGAAAAACACTTGAAGAGGTGGGGGAAGACTACCTTAAAGAGCTTATTCAAAGAAGCCTTATTGTCACTAATGAAGTCGATTTTGACGGACAGCCAAAAACTTGTCGTGTTCATCATCTCCTGCATAAAATCATCTTCGCCAAGTCCCAAGAGGAAAATTTCTGTGGCATTTACATACAACCTGGTGCATATTTGAATGAGAAAGTTCGTCGACTATCCATCCAGCGAAGTTGCACAAATATGCTGCATATGAACTATGCTCATTGTCGCTCATTCTTCATGTCTGGGATACTTCGCCATCTGCTTGTATATCGCTACAACCTGAAGAGTTATGTTACTATTGACTGTGCACAAGGATTCAAGGTCTGTAATGGGATTAGGAGACTAGTAGCATTACAAAAGTTGTCACTGATAAAGGCAAATGGAGATAATGGTATAATAAGTGAACTAGAGAATCTGACACAGCTGCGGAAATTGGGGGTCACCGGCTTAAAAGAACAAGATGGTGGGTACTTATGTCGCTCAATTATGAATATGAAAAATCTCCAATCACTAGATTTAGCATCAATTCATGAAAATGAATATCTTGATCTAAGTTTAATTCATGATCCTCCTATGCTCCTACAACGCCTTTACCTGAAAGGTCAGTTGCGGAACATACCGGATTGGATATGTTCTCTACACGACCTTGTCAGGATACGTTTAAAATGGTCAAAGTTGGATTGCAGCCCCATTGATGCCCTCCAAGATCGTCCAAATCTGGTAGAACTGCAGTTGCTTGATGCATATACTGGAAAAAAATTGGTGTTTTATGCTAGAAAATTTCCAAGTCTGAAGATACTAGAGCTAGAAAAAATGGAGGCACTTGAGGAAGTAAGAATTCGGAAAGGTAGCTTAGATAACCTTGAAAAGTTAATTATAAGGCGATGTGAAAAGATAAAGATTGTGCTTCAAGGGATTGATAGACTTCCTCACCTGAAGGAGTTGCATTTATATGAGATGCCAGATAAATTTCTGAATGGGATTGAAAAGAATGGTGGGAAATTTCGTCAGCTTGTCCAGCATATTCCTGTCATTTATTCTTTTACTCTTGACACAAATGGGTACTGGAAGCCTAGAGATCTTTCATAA


Protein sequences

Name Description Sequence
Disease resistance protein RPH8A, putative Disease resistance protein RPH8A, putative [Ricinus communis].

MAAADGAVSFLLQKFDTLIAREWNLFSGIKTEVGGLKNEFEMMRAILKEADDAKRESNEQVRVWIKQVRDLAYDIEDILDMYAFHTCQHSSSSSSSSSSIYPKFLRWKRSRSISVLVQDMKNKLSGVKEMRERYQLIASSPQASSSCQENYKHFQYPRVASLYTDEADIVGIEEPRDKLMAWAVNGESSLKVVFLVGMAGLGKTLVAKKVYEGTKKSFDCCAWIPISVSQKKEELLWTILKRLFESNDEPIPREYYTISIVQLMDKMRSFLQHRRYIVVFDDLWDKDVWEFIKYALPNRIHSRVIITTRRGDIAHFYHHDSVGVYNLQPLPLEKAQELFYNKTFQSSGVCPSGLIEWSGKFLKQCEGLPLGIVAISNLLANTEKTADAWRKLHDSLGSELDSNGHLSSVTNVISPSYDDLPYSLKYCLLYFSIFPEEYSIKRRKLIRLWISEGLVKEVMGKTLEEVGEDYLKELIQRSLIVTNEVDFDGQPKTCRVHHLLHKIIFAKSQEENFCGIYIQPGAYLNEKVRRLSIQRSCTNMLHMNYAHCRSFFMSGILRHLLVYRYNLKSYVTIDCAQGFKVCNGIRRLVALQKLSLIKANGDNGIISELENLTQLRKLGVTGLKEQDGGYLCRSIMNMKNLQSLDLASIHENEYLDLSLIHDPPMLLQRLYLKGQLRNIPDWICSLHDLVRIRLKWSKLDCSPIDALQDRPNLVELQLLDAYTGKKLVFYARKFPSLKILELEKMEALEEVRIRKGSLDNLEKLIIRRCEKIKIVLQGIDRLPHLKELHLYEMPDKFLNGIEKNGGKFRQLVQHIPVIYSFTLDTNGYWKPRDLS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
4-834 PTHR23155:SF121,SUBFAMILY NOT NAMED

ADGAVSFLLQKFDTLIAREWNLFSGIKTEVGGLKNEFEMMRAILKEADDAKRESNEQVRVWIKQVRDLAYDIEDILDMYAFHTCQHSSSSSSSSSSIYPKFLRWKRSRSISVLVQDMKNKLSGVKEMRERYQLIASSPQASSSCQENYKHFQYPRVASLYTDEADIVGIEEPRDKLMAWAVNGESSLKVVFLVGMAGLGKTLVAKKVYEGTKKSFDCCAWIPISVSQKKEELLWTILKRLFESNDEPIPREYYTISIVQLMDKMRSFLQHRRYIVVFDDLWDKDVWEFIKYALPNRIHSRVIITTRRGDIAHFYHHDSVGVYNLQPLPLEKAQELFYNKTFQSSGVCPSGLIEWSGKFLKQCEGLPLGIVAISNLLANTEKTADAWRKLHDSLGSELDSNGHLSSVTNVISPSYDDLPYSLKYCLLYFSIFPEEYSIKRRKLIRLWISEGLVKEVMGKTLEEVGEDYLKELIQRSLIVTNEVDFDGQPKTCRVHHLLHKIIFAKSQEENFCGIYIQPGAYLNEKVRRLSIQRSCTNMLHMNYAHCRSFFMSGILRHLLVYRYNLKSYVTIDCAQGFKVCNGIRRLVALQKLSLIKANGDNGIISELENLTQLRKLGVTGLKEQDGGYLCRSIMNMKNLQSLDLASIHENEYLDLSLIHDPPMLLQRLYLKGQLRNIPDWICSLHDLVRIRLKWSKLDCSPIDALQDRPNLVELQLLDAYTGKKLVFYARKFPSLKILELEKMEALEEVRIRKGSLDNLEKLIIRRCEKIKIVLQGIDRLPHLKELHLYEMPDKFLNGIEKNGGKFRQLVQHIPVIYSFTLDTNGYWKPRDL

HMMPanther: PTHR23155
4-834 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ADGAVSFLLQKFDTLIAREWNLFSGIKTEVGGLKNEFEMMRAILKEADDAKRESNEQVRVWIKQVRDLAYDIEDILDMYAFHTCQHSSSSSSSSSSIYPKFLRWKRSRSISVLVQDMKNKLSGVKEMRERYQLIASSPQASSSCQENYKHFQYPRVASLYTDEADIVGIEEPRDKLMAWAVNGESSLKVVFLVGMAGLGKTLVAKKVYEGTKKSFDCCAWIPISVSQKKEELLWTILKRLFESNDEPIPREYYTISIVQLMDKMRSFLQHRRYIVVFDDLWDKDVWEFIKYALPNRIHSRVIITTRRGDIAHFYHHDSVGVYNLQPLPLEKAQELFYNKTFQSSGVCPSGLIEWSGKFLKQCEGLPLGIVAISNLLANTEKTADAWRKLHDSLGSELDSNGHLSSVTNVISPSYDDLPYSLKYCLLYFSIFPEEYSIKRRKLIRLWISEGLVKEVMGKTLEEVGEDYLKELIQRSLIVTNEVDFDGQPKTCRVHHLLHKIIFAKSQEENFCGIYIQPGAYLNEKVRRLSIQRSCTNMLHMNYAHCRSFFMSGILRHLLVYRYNLKSYVTIDCAQGFKVCNGIRRLVALQKLSLIKANGDNGIISELENLTQLRKLGVTGLKEQDGGYLCRSIMNMKNLQSLDLASIHENEYLDLSLIHDPPMLLQRLYLKGQLRNIPDWICSLHDLVRIRLKWSKLDCSPIDALQDRPNLVELQLLDAYTGKKLVFYARKFPSLKILELEKMEALEEVRIRKGSLDNLEKLIIRRCEKIKIVLQGIDRLPHLKELHLYEMPDKFLNGIEKNGGKFRQLVQHIPVIYSFTLDTNGYWKPRDL

superfamily: SSF52540
152-403 SSF52540

KHFQYPRVASLYTDEADIVGIEEPRDKLMAWAVNGESSLKVVFLVGMAGLGKTLVAKKVYEGTKKSFDCCAWIPISVSQKKEELLWTILKRLFESNDEPIPREYYTISIVQLMDKMRSFLQHRRYIVVFDDLWDKDVWEFIKYALPNRIHSRVIITTRRGDIAHFYHHDSVGVYNLQPLPLEKAQELFYNKTFQSSGVCPSGLIEWSGKFLKQCEGLPLGIVAISNLLANTEKTADAWRKLHDSLGSELDSN

HMMPfam: PF00931
IPR002182
177-457 NB-ARC,NBS
NB-ARC

DKLMAWAVNGESSLKVVFLVGMAGLGKTLVAKKVYEGTKKSFDCCAWIPISVSQKKEELLWTILKRLFESNDEPIPREYYTISIVQLMDKMRSFLQHRRYIVVFDDLWDKDVWEFIKYALPNRIHSRVIITTRRGDIAHFYHHDSVGVYNLQPLPLEKAQELFYNKTFQSSGVCPSGLIEWSGKFLKQCEGLPLGIVAISNLLANTEKTADAWRKLHDSLGSELDSNGHLSSVTNVISPSYDDLPYSLKYCLLYFSIFPEEYSIKRRKLIRLWISEGLVKE

Gene3D: G3DSA:3.40.50.300
179-317 G3DSA:3.40.50.300

LMAWAVNGESSLKVVFLVGMAGLGKTLVAKKVYEGTKKSFDCCAWIPISVSQKKEELLWTILKRLFESNDEPIPREYYTISIVQLMDKMRSFLQHRRYIVVFDDLWDKDVWEFIKYALPNRIHSRVIITTRRGDIAHFY

FPrintScan: PR00364
IPR000767
192-207 DISEASERSIST
Disease resistance protein

VVFLVGMAGLGKTLVA

FPrintScan: PR00364
IPR000767
270-284 DISEASERSIST
Disease resistance protein

FLQHRRYIVVFDDLW

FPrintScan: PR00364
IPR000767
365-379 DISEASERSIST
Disease resistance protein

CEGLPLGIVAISNLL

superfamily: SSF52058
495-794 SSF52058,LRR

RVHHLLHKIIFAKSQEENFCGIYIQPGAYLNEKVRRLSIQRSCTNMLHMNYAHCRSFFMSGILRHLLVYRYNLKSYVTIDCAQGFKVCNGIRRLVALQKLSLIKANGDNGIISELENLTQLRKLGVTGLKEQDGGYLCRSIMNMKNLQSLDLASIHENEYLDLSLIHDPPMLLQRLYLKGQLRNIPDWICSLHDLVRIRLKWSKLDCSPIDALQDRPNLVELQLLDAYTGKKLVFYARKFPSLKILELEKMEALEEVRIRKGSLDNLEKLIIRRCEKIKIVLQGIDRLPHLKELHLYEMP

Gene3D: G3DSA:3.80.10.10
584-792 G3DSA:3.80.10.10

GIRRLVALQKLSLIKANGDNGIISELENLTQLRKLGVTGLKEQDGGYLCRSIMNMKNLQSLDLASIHENEYLDLSLIHDPPMLLQRLYLKGQLRNIPDWICSLHDLVRIRLKWSKLDCSPIDALQDRPNLVELQLLDAYTGKKLVFYARKFPSLKILELEKMEALEEVRIRKGSLDNLEKLIIRRCEKIKIVLQGIDRLPHLKELHLYE

FPrintScan: PR00364
IPR000767
732-748 DISEASERSIST
Disease resistance protein

RKFPSLKILELEKMEAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox