PRGDB00062223 (Disease resistance protein RPM1, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RPM1, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255573982 (XM_002527863)
Gene Class Unknown
Domain Type LRR
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RPM1, putative, mRNA.

DNA Sequence

ATGCCTCACTTCTACTTCACTTGTAATTCAGATAATATAGAATCCTTTGTTGCGGAATTACTGAGAAAGAAAAATCAAGATGATGGTGTTCTAAGTATATCACTTGACGATGGAAACAGATCGTCAATGTCGAGCATAGCTGCCAACAAAGATGAAAGCGACTGTTTAGCAGCTCTGAAATCAGATTATGAAAAGCTTCCTGATCGTCTCAAGTGCTGCTTTGAGTACTGCTGCATCTCCATCAGATACTCTATGGAGAAGGGGAAACTAATTCGGCTTTTGTTGGCTGAACGTCTAATACAGGAAAAGAATGGGAGTATCATGGAGGATATAGCTGCCAGCATAATTACAGAATTAATTGGCATAGGAATGCTTCAAGAAGAACAAGATGGAAGTGGGAATATTCTTCAAGTGCCCAGCTTGCTTCGCCAATTGTCTCTTATTAAAACAGAGAAACAAGATTTTGTCACTAACCCTGCAAATTTACTCTTGCGTCTGGTAATCAGGGACCATGGTAAAGGCATCCCTTCTAGCTTGAAAAGTCTTTTAATTCGATCTCTGTTCATGGTGACTGCTGAACGCTGTGGATCTTCTTCCTTTGAATCTGAAAGTGGCATTTCTGGGGCCTCCATGGAAACTATATGCGGATTTCAATTTCTGTTGGTGTTGGATGTGGATGGTAAAATAGAATATTTACCCAATGAAATAGGGGATTTGGTTCACCTGAGATATTTAGGCTTGGAAAACTCAGATCTGAATGAGCTTCCACAGGCTTTAGGCAATCTTCAGAAACTTCAAACTTTGGATATAAGAATGTGCGGATGGCTGCATGAACTACCAATTGAAGTTCTGAGAATTAAACAATTGAGGCACCTTCTTATGTCCAGAAGCATCGAATATGGTGAAATTATAGTACCCAAAGGGATTGGTAAGTTGGTGAATCTCCACACTTTCACTGGTGTGTATGCTGGAGGTGGCATTGCTAGTGAATTGAGCACCTTAACCCAATTACGAGAGCTTGGCGTTAAGCGAGTCAGCGAAGATCATGCCAGTGAGCTATATGCAGCCATCATGAAAATGGGAAATCTCATCTCCTTGTCACTAGAAGCAGAGCAAAACTACTGTGAAGATACAGATGAAAGGTTTTCGCTTCTTCCTGAATTTGAATTATTTTCCCCTCCACCTGTTCTTCAGGAGCTTTATATAGATGGTGGCCTAATTGAAATGCCCATTTGGCTTGCCTCCATGTCAAACCTCACCACTTTAAATTTATTCCACTCTGACCTACAAGAGATGCCAACTTCAGTCCTTCAGTTTCTACCCAAATTAAAACATCTCACTCTATGGGAAGCCTACAGAGGAAAGCAAATTGGTAAAGATTTCTGCCAAGCAGGTGGGTTCCGGGAGTTGCAAACTCTTACAATTGCTTCCAAGTTTCTAGTGGAATGGACAGAGATTGAAAATGAAGCATTTCCAAAATTAAAATGTCTTAGTTTTCGTTGCTGTTTAGAGTTGAGATTTCTTCCTGAAGGTTTACAAAACATTTCTACACTTGAGGAACTAGCTTTGATTCCTATGCATGAAGACCTTGCTTGGAGATTAATCAATGAAGAAAATTACAAGATCAAGCATATCTCAAAACTCAGGGCTTGCTATCGACAAAAATTTTGCGGGATTTTCGTAGGAGATCCGAAGGATGTGTTGTTGAGCGCCTGA


Protein sequences

Name Description Sequence
Disease resistance protein RPM1, putative Disease resistance protein RPM1, putative [Ricinus communis].

MPHFYFTCNSDNIESFVAELLRKKNQDDGVLSISLDDGNRSSMSSIAANKDESDCLAALKSDYEKLPDRLKCCFEYCCISIRYSMEKGKLIRLLLAERLIQEKNGSIMEDIAASIITELIGIGMLQEEQDGSGNILQVPSLLRQLSLIKTEKQDFVTNPANLLLRLVIRDHGKGIPSSLKSLLIRSLFMVTAERCGSSSFESESGISGASMETICGFQFLLVLDVDGKIEYLPNEIGDLVHLRYLGLENSDLNELPQALGNLQKLQTLDIRMCGWLHELPIEVLRIKQLRHLLMSRSIEYGEIIVPKGIGKLVNLHTFTGVYAGGGIASELSTLTQLRELGVKRVSEDHASELYAAIMKMGNLISLSLEAEQNYCEDTDERFSLLPEFELFSPPPVLQELYIDGGLIEMPIWLASMSNLTTLNLFHSDLQEMPTSVLQFLPKLKHLTLWEAYRGKQIGKDFCQAGGFRELQTLTIASKFLVEWTEIENEAFPKLKCLSFRCCLELRFLPEGLQNISTLEELALIPMHEDLAWRLINEENYKIKHISKLRACYRQKFCGIFVGDPKDVLLSA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
11-564 PTHR23155:SF121,SUBFAMILY NOT NAMED

DNIESFVAELLRKKNQDDGVLSISLDDGNRSSMSSIAANKDESDCLAALKSDYEKLPDRLKCCFEYCCISIRYSMEKGKLIRLLLAERLIQEKNGSIMEDIAASIITELIGIGMLQEEQDGSGNILQVPSLLRQLSLIKTEKQDFVTNPANLLLRLVIRDHGKGIPSSLKSLLIRSLFMVTAERCGSSSFESESGISGASMETICGFQFLLVLDVDGKIEYLPNEIGDLVHLRYLGLENSDLNELPQALGNLQKLQTLDIRMCGWLHELPIEVLRIKQLRHLLMSRSIEYGEIIVPKGIGKLVNLHTFTGVYAGGGIASELSTLTQLRELGVKRVSEDHASELYAAIMKMGNLISLSLEAEQNYCEDTDERFSLLPEFELFSPPPVLQELYIDGGLIEMPIWLASMSNLTTLNLFHSDLQEMPTSVLQFLPKLKHLTLWEAYRGKQIGKDFCQAGGFRELQTLTIASKFLVEWTEIENEAFPKLKCLSFRCCLELRFLPEGLQNISTLEELALIPMHEDLAWRLINEENYKIKHISKLRACYRQKFCGIFVGDP

HMMPanther: PTHR23155
11-564 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DNIESFVAELLRKKNQDDGVLSISLDDGNRSSMSSIAANKDESDCLAALKSDYEKLPDRLKCCFEYCCISIRYSMEKGKLIRLLLAERLIQEKNGSIMEDIAASIITELIGIGMLQEEQDGSGNILQVPSLLRQLSLIKTEKQDFVTNPANLLLRLVIRDHGKGIPSSLKSLLIRSLFMVTAERCGSSSFESESGISGASMETICGFQFLLVLDVDGKIEYLPNEIGDLVHLRYLGLENSDLNELPQALGNLQKLQTLDIRMCGWLHELPIEVLRIKQLRHLLMSRSIEYGEIIVPKGIGKLVNLHTFTGVYAGGGIASELSTLTQLRELGVKRVSEDHASELYAAIMKMGNLISLSLEAEQNYCEDTDERFSLLPEFELFSPPPVLQELYIDGGLIEMPIWLASMSNLTTLNLFHSDLQEMPTSVLQFLPKLKHLTLWEAYRGKQIGKDFCQAGGFRELQTLTIASKFLVEWTEIENEAFPKLKCLSFRCCLELRFLPEGLQNISTLEELALIPMHEDLAWRLINEENYKIKHISKLRACYRQKFCGIFVGDP

superfamily: SSF52058
170-562 SSF52058,LRR

DHGKGIPSSLKSLLIRSLFMVTAERCGSSSFESESGISGASMETICGFQFLLVLDVDGKIEYLPNEIGDLVHLRYLGLENSDLNELPQALGNLQKLQTLDIRMCGWLHELPIEVLRIKQLRHLLMSRSIEYGEIIVPKGIGKLVNLHTFTGVYAGGGIASELSTLTQLRELGVKRVSEDHASELYAAIMKMGNLISLSLEAEQNYCEDTDERFSLLPEFELFSPPPVLQELYIDGGLIEMPIWLASMSNLTTLNLFHSDLQEMPTSVLQFLPKLKHLTLWEAYRGKQIGKDFCQAGGFRELQTLTIASKFLVEWTEIENEAFPKLKCLSFRCCLELRFLPEGLQNISTLEELALIPMHEDLAWRLINEENYKIKHISKLRACYRQKFCGIFVG

Gene3D: G3DSA:3.80.10.10
204-315 G3DSA:3.80.10.10

SGISGASMETICGFQFLLVLDVDGKIEYLPNEIGDLVHLRYLGLENSDLNELPQALGNLQKLQTLDIRMCGWLHELPIEVLRIKQLRHLLMSRSIEYGEIIVPKGIGKLVNL

Gene3D: G3DSA:3.80.10.10
397-523 G3DSA:3.80.10.10

LQELYIDGGLIEMPIWLASMSNLTTLNLFHSDLQEMPTSVLQFLPKLKHLTLWEAYRGKQIGKDFCQAGGFRELQTLTIASKFLVEWTEIENEAFPKLKCLSFRCCLELRFLPEGLQNISTLEELAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox