PRGDB00062225 (Disease resistance protein RPM1, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RPM1, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255569097 (XM_002525472)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RPM1, putative, mRNA.

DNA Sequence

ATGCAAAGAAAGAAGAACAAGAAAGAAAAGAAGGAAGAAGAAGAAGAAGAAGAAGAATTTACAAGCATGGCAGCGGTTCCAGCAGACTTCTTGATTGGTAAGATAGTTTCTCTTATTGAAAATGAGGCAGCCTTGTTGGGAGGAGCTGGAGATGAACTTGAAGAAATCAGATGGGAGCTAGTGAGCATGAGATCCTTTCTAGAGGATACAGAAAAGAAAAGGCCTCAAACAGAAGGAGAGAAAACATGGGTGGCTAGCGTGAGAAACTTGGTTTATGACGTTGAAGATATAATTGATGAGTTCATGTACCAGACAAACAAGCGACATGGCAGGCATCAATTCACAAGAACACTCCACAAAACCATTGGCTTCCCCAAATATCTTTGGGAAAAGCATAAGATTGCCTCCAGGTTACAGAAGATCAAGCGTATGACTAAAGCCATCCCGGAGAGAAATCATCGGTATGGCGTTGACCATATAGAAGAAAGATCAGTTGACAATGAAAGAGGGAATATCCGTGGGGAATCATCTTTGTTTCTTAAAGATGATCTTGTGGGCATTGAAAATGATAGAGAAGTATTAGTTGAATGGCTGACAAATGGGGAGTCCCAAAGAACGACTATTTCAGTGGTGGGAATGGGGGGCTCTGGCAAGACAACTCTAGCTGCCAAGGCCTATAATTGCCAAACTGTGCAGCGCCACTTGGATTGCTCTGCTTGGATTACTGTCTCTCAGAATTACCTGATTGATGACTTGTTCAGAAGCTTGATTAAGCAATTCTATCAAGCAATGAAAGAAGCAGTTCCAGCAGATTTGAGCATAATGAGCTACCGACAACTAGTACAAATGCTTGTGAACTACCTAGAACCAAAAAGGTATATGGTCGTTCTGGATGATGTATGGGATCCAGACTTATGGAATCAAATAAAAATCTCACTTCCGAACAGCCAGCATGGCTGTCGAGTCATGATTACGACTCGGAAAGAAGACATAGCATCTCTCTCTTATGATGTTGGAAGCCATGTCCACCATATCAGACCACTGACAAACAATGAAGCATGGACCTTATTTTGCATCAAAGCTTTTCCAAGGAATGGAAAAAGATGTCCCCCCGAGTTTGAGATCTTAGCTAAGGACATTGTGGAAAAATGTCGAGGACTGCCTCTTGCAATTGTGGCACTAGGCGGTCTCTTGTCTGCCAAAAGTTCAGAGTCGGAGTGGAGGATGATTTATAACAGCCTGAATTGGGAGTTGAGCAACAATCCAATGCTTCAATCAGTTAAAAGCATCTTATTGCTGAGCTACAATGATCTACCGTACCGACTTAAGCATTGTTTCTTATATTGCTGCTTGTTCCCCGAAGATTACCCAATCAAGCGGAAGAGACTCATCAGATTATGGATGGCAGAGGGGTTTGTAGAAAAAATCAAAGGGATAACACCAGAAGAGGTAGCTGAGAAATACCTCTTGGAACTTATCCGTCGAAGCATGCTTCAACCAGTAGAGAGGAACTCCGCAGGACTCCCAAAGGCCTGTAAGATGCATGATTTAGTCAGGGAGCTTGCTCTCTCAATATCAGAAGAACAGAAATTTTGTGCTGCATATGATGAGCAAAGTACTGCAGCAGCAAGAGAAGATGGAATAGCACGTCGCCTGTCGATTCAAGCAAGAGAAAGAGAAATCAAATTCTGTGGTGGTATGTCACAGCTTCGCTCTTTCCTTTTGTTTGTCATTGATAAGCTAAATCCATCTTCACTAAACGCATTGCCATCTGACTTTAAACTCCTGAGGGTATTAGACTTGGAAGATGCTCCAATTGAGAAATTGCCTAATAGGATAGTCACTTTGTTCAATATGAGATACTTGAACTTGAAAAAGACTCGAGTTAAGGAGCTGCCAAAGTCCATTGGAAGATTGCACAACCTTGAAACATTAAACATCGATGACACCAATGTTGAAGCTCTTCCAAATGGGATTGTGAAGTTGCAGAACTTACGGTATTTGCTCTGTCGCCACTTTAAGCATGGCCAGCACTATGATTTCAATTATGTAACTGGAACACAGATACCAGCCATAAGCACCTTGAAGAACTTGCAAGTTTTAGGTTGCATAGTAGCCAATGGTGATATCCTGAGACAACTCAGAAGCATGACTCAACTTGTAAGGCTTGATATTTCAATGGTTAAAGGATCAGATGAAATGGACTTGTGCTCATCAATTCAAAACATGCCACTCCTCCGCCGCTTATTTGTGATGGCAAGCAATGGCGAGATCCTTCGAATGGATGCACTGAAATCCCCACCTCCACAACTTGGCAGGCTTTGCTTGGTGGGGAAATTGGAGAAGATCCCACAATGGTTTCACTCACTTATGAATCTTCGGGTCTTGTACCTTCGTTGGTCTGAACTAGATGAAGATCCACTTTCAGATCTCCAAGAACTCCCCAATTTGACGTGTCTTACACTAGTTGAAGCTTACAAGGGGCGAAACTTGACCTTTTCAAAAGGATTTAACCGTCTTGAGATTTTGGGTTTGTATAATTGTCCTAAACTGCAAAGCATAATTATAGCCGAGGGAGTAATGTCAGGCATCAAAGAGTTAAGCATTGACAATTGCAGAGAGTTGATGAGACTGCCTTTTGGAATTCAGTATCTTACCAAACTTGAAGAACTGACACTGATAAATGTCTCAACGGAACTCACTGATAGCATCCGTATGCCTTTCGGGATGGATCGTCGAAGGGTCAAGCACATTCCCAAAATCAACAACTTCTACTCCACACCATCCGGATGGTTTCAGGAAAGCCTGTCCTAG


Protein sequences

Name Description Sequence
Disease resistance protein RPM1, putative Disease resistance protein RPM1, putative [Ricinus communis].

MQRKKNKKEKKEEEEEEEEFTSMAAVPADFLIGKIVSLIENEAALLGGAGDELEEIRWELVSMRSFLEDTEKKRPQTEGEKTWVASVRNLVYDVEDIIDEFMYQTNKRHGRHQFTRTLHKTIGFPKYLWEKHKIASRLQKIKRMTKAIPERNHRYGVDHIEERSVDNERGNIRGESSLFLKDDLVGIENDREVLVEWLTNGESQRTTISVVGMGGSGKTTLAAKAYNCQTVQRHLDCSAWITVSQNYLIDDLFRSLIKQFYQAMKEAVPADLSIMSYRQLVQMLVNYLEPKRYMVVLDDVWDPDLWNQIKISLPNSQHGCRVMITTRKEDIASLSYDVGSHVHHIRPLTNNEAWTLFCIKAFPRNGKRCPPEFEILAKDIVEKCRGLPLAIVALGGLLSAKSSESEWRMIYNSLNWELSNNPMLQSVKSILLLSYNDLPYRLKHCFLYCCLFPEDYPIKRKRLIRLWMAEGFVEKIKGITPEEVAEKYLLELIRRSMLQPVERNSAGLPKACKMHDLVRELALSISEEQKFCAAYDEQSTAAAREDGIARRLSIQAREREIKFCGGMSQLRSFLLFVIDKLNPSSLNALPSDFKLLRVLDLEDAPIEKLPNRIVTLFNMRYLNLKKTRVKELPKSIGRLHNLETLNIDDTNVEALPNGIVKLQNLRYLLCRHFKHGQHYDFNYVTGTQIPAISTLKNLQVLGCIVANGDILRQLRSMTQLVRLDISMVKGSDEMDLCSSIQNMPLLRRLFVMASNGEILRMDALKSPPPQLGRLCLVGKLEKIPQWFHSLMNLRVLYLRWSELDEDPLSDLQELPNLTCLTLVEAYKGRNLTFSKGFNRLEILGLYNCPKLQSIIIAEGVMSGIKELSIDNCRELMRLPFGIQYLTKLEELTLINVSTELTDSIRMPFGMDRRRVKHIPKINNFYSTPSGWFQESLS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF234
24-937 PTHR23155:SF234,RPM1 (RESISTANCE TO P. SYRINGAE PV MACULICOLA 1)

AAVPADFLIGKIVSLIENEAALLGGAGDELEEIRWELVSMRSFLEDTEKKRPQTEGEKTWVASVRNLVYDVEDIIDEFMYQTNKRHGRHQFTRTLHKTIGFPKYLWEKHKIASRLQKIKRMTKAIPERNHRYGVDHIEERSVDNERGNIRGESSLFLKDDLVGIENDREVLVEWLTNGESQRTTISVVGMGGSGKTTLAAKAYNCQTVQRHLDCSAWITVSQNYLIDDLFRSLIKQFYQAMKEAVPADLSIMSYRQLVQMLVNYLEPKRYMVVLDDVWDPDLWNQIKISLPNSQHGCRVMITTRKEDIASLSYDVGSHVHHIRPLTNNEAWTLFCIKAFPRNGKRCPPEFEILAKDIVEKCRGLPLAIVALGGLLSAKSSESEWRMIYNSLNWELSNNPMLQSVKSILLLSYNDLPYRLKHCFLYCCLFPEDYPIKRKRLIRLWMAEGFVEKIKGITPEEVAEKYLLELIRRSMLQPVERNSAGLPKACKMHDLVRELALSISEEQKFCAAYDEQSTAAAREDGIARRLSIQAREREIKFCGGMSQLRSFLLFVIDKLNPSSLNALPSDFKLLRVLDLEDAPIEKLPNRIVTLFNMRYLNLKKTRVKELPKSIGRLHNLETLNIDDTNVEALPNGIVKLQNLRYLLCRHFKHGQHYDFNYVTGTQIPAISTLKNLQVLGCIVANGDILRQLRSMTQLVRLDISMVKGSDEMDLCSSIQNMPLLRRLFVMASNGEILRMDALKSPPPQLGRLCLVGKLEKIPQWFHSLMNLRVLYLRWSELDEDPLSDLQELPNLTCLTLVEAYKGRNLTFSKGFNRLEILGLYNCPKLQSIIIAEGVMSGIKELSIDNCRELMRLPFGIQYLTKLEELTLINVSTELTDSIRMPFGMDRRRVKHIPKINNFYSTPSGWFQESLS

HMMPanther: PTHR23155
24-937 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AAVPADFLIGKIVSLIENEAALLGGAGDELEEIRWELVSMRSFLEDTEKKRPQTEGEKTWVASVRNLVYDVEDIIDEFMYQTNKRHGRHQFTRTLHKTIGFPKYLWEKHKIASRLQKIKRMTKAIPERNHRYGVDHIEERSVDNERGNIRGESSLFLKDDLVGIENDREVLVEWLTNGESQRTTISVVGMGGSGKTTLAAKAYNCQTVQRHLDCSAWITVSQNYLIDDLFRSLIKQFYQAMKEAVPADLSIMSYRQLVQMLVNYLEPKRYMVVLDDVWDPDLWNQIKISLPNSQHGCRVMITTRKEDIASLSYDVGSHVHHIRPLTNNEAWTLFCIKAFPRNGKRCPPEFEILAKDIVEKCRGLPLAIVALGGLLSAKSSESEWRMIYNSLNWELSNNPMLQSVKSILLLSYNDLPYRLKHCFLYCCLFPEDYPIKRKRLIRLWMAEGFVEKIKGITPEEVAEKYLLELIRRSMLQPVERNSAGLPKACKMHDLVRELALSISEEQKFCAAYDEQSTAAAREDGIARRLSIQAREREIKFCGGMSQLRSFLLFVIDKLNPSSLNALPSDFKLLRVLDLEDAPIEKLPNRIVTLFNMRYLNLKKTRVKELPKSIGRLHNLETLNIDDTNVEALPNGIVKLQNLRYLLCRHFKHGQHYDFNYVTGTQIPAISTLKNLQVLGCIVANGDILRQLRSMTQLVRLDISMVKGSDEMDLCSSIQNMPLLRRLFVMASNGEILRMDALKSPPPQLGRLCLVGKLEKIPQWFHSLMNLRVLYLRWSELDEDPLSDLQELPNLTCLTLVEAYKGRNLTFSKGFNRLEILGLYNCPKLQSIIIAEGVMSGIKELSIDNCRELMRLPFGIQYLTKLEELTLINVSTELTDSIRMPFGMDRRRVKHIPKINNFYSTPSGWFQESLS

superfamily: SSF52540
167-421 SSF52540

NERGNIRGESSLFLKDDLVGIENDREVLVEWLTNGESQRTTISVVGMGGSGKTTLAAKAYNCQTVQRHLDCSAWITVSQNYLIDDLFRSLIKQFYQAMKEAVPADLSIMSYRQLVQMLVNYLEPKRYMVVLDDVWDPDLWNQIKISLPNSQHGCRVMITTRKEDIASLSYDVGSHVHHIRPLTNNEAWTLFCIKAFPRNGKRCPPEFEILAKDIVEKCRGLPLAIVALGGLLSAKSSESEWRMIYNSLNWELSNN

HMMPfam: PF00931
IPR002182
188-476 NB-ARC,NBS
NB-ARC

ENDREVLVEWLTNGESQRTTISVVGMGGSGKTTLAAKAYNCQTVQRHLDCSAWITVSQNYLIDDLFRSLIKQFYQAMKEAVPADLSIMSYRQLVQMLVNYLEPKRYMVVLDDVWDPDLWNQIKISLPNSQHGCRVMITTRKEDIASLSYDVGSHVHHIRPLTNNEAWTLFCIKAFPRNGKRCPPEFEILAKDIVEKCRGLPLAIVALGGLLSAKSSESEWRMIYNSLNWELSNNPMLQSVKSILLLSYNDLPYRLKHCFLYCCLFPEDYPIKRKRLIRLWMAEGFVEKI

Gene3D: G3DSA:3.40.50.300
191-333 G3DSA:3.40.50.300

REVLVEWLTNGESQRTTISVVGMGGSGKTTLAAKAYNCQTVQRHLDCSAWITVSQNYLIDDLFRSLIKQFYQAMKEAVPADLSIMSYRQLVQMLVNYLEPKRYMVVLDDVWDPDLWNQIKISLPNSQHGCRVMITTRKEDIAS

FPrintScan: PR00364
IPR000767
207-222 DISEASERSIST
Disease resistance protein

TISVVGMGGSGKTTLA

FPrintScan: PR00364
IPR000767
287-301 DISEASERSIST
Disease resistance protein

YLEPKRYMVVLDDVW

FPrintScan: PR00364
IPR000767
384-398 DISEASERSIST
Disease resistance protein

CRGLPLAIVALGGLL

superfamily: SSF52058
513-895 SSF52058,LRR

KMHDLVRELALSISEEQKFCAAYDEQSTAAAREDGIARRLSIQAREREIKFCGGMSQLRSFLLFVIDKLNPSSLNALPSDFKLLRVLDLEDAPIEKLPNRIVTLFNMRYLNLKKTRVKELPKSIGRLHNLETLNIDDTNVEALPNGIVKLQNLRYLLCRHFKHGQHYDFNYVTGTQIPAISTLKNLQVLGCIVANGDILRQLRSMTQLVRLDISMVKGSDEMDLCSSIQNMPLLRRLFVMASNGEILRMDALKSPPPQLGRLCLVGKLEKIPQWFHSLMNLRVLYLRWSELDEDPLSDLQELPNLTCLTLVEAYKGRNLTFSKGFNRLEILGLYNCPKLQSIIIAEGVMSGIKELSIDNCRELMRLPFGIQYLTKLEELTLIN

Gene3D: G3DSA:3.80.10.10
568-696 G3DSA:3.80.10.10

SQLRSFLLFVIDKLNPSSLNALPSDFKLLRVLDLEDAPIEKLPNRIVTLFNMRYLNLKKTRVKELPKSIGRLHNLETLNIDDTNVEALPNGIVKLQNLRYLLCRHFKHGQHYDFNYVTGTQIPAISTLK

Gene3D: G3DSA:3.80.10.10
697-895 G3DSA:3.80.10.10

NLQVLGCIVANGDILRQLRSMTQLVRLDISMVKGSDEMDLCSSIQNMPLLRRLFVMASNGEILRMDALKSPPPQLGRLCLVGKLEKIPQWFHSLMNLRVLYLRWSELDEDPLSDLQELPNLTCLTLVEAYKGRNLTFSKGFNRLEILGLYNCPKLQSIIIAEGVMSGIKELSIDNCRELMRLPFGIQYLTKLEELTLIN

FPrintScan: PR00364
IPR000767
859-875 DISEASERSIST
Disease resistance protein

GVMSGIKELSIDNCREL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox