PRGDB00062226 (Disease resistance protein RGA2, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RGA2, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255568718 (XM_002525285)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RGA2, putative, mRNA.

DNA Sequence

ATGGCAGGGGCGTTGATAGGAGGGTCATTTCTGTCAGCTTTCCTTCAGGTGTTGTTTGATAGAATGGCTTCTCGCGAGGTTCTTGACTTCTTTAAAGGCCAAAAGCTCAACGATGCACTGTTGAACAAGTTGAAGACTACCATGATTTCTGTTAATGCAGTGCTTGACGATGCAGAAGAGAAGCAAATCACTAAACCAGCTGTGAAGGAATGGCTTGACGAGCTCAAAGATGCTGCCTACGAAGCTGATGACTTGTTGGATGAAATCGCTTATGAATGTTTGAGGTCGGAAGTGGAAGCTACTTCTCAAACCGATGTGGATCAGGTGCGGAACTTCTTCTCTAATTTTTCTCCATTTAAGAAGGTGAAGGAAGTAAAGTTAGAAGAGGTCTCAAAGCTAGAAGAGATCCTTGAGAGACTGGAACTTCTAGTGAAACAAAAGGAAGCACTTGGTCTTAGAGAGGGTATTGAAGAAAGGCATTCACACAAGATACCAACAACTTCTCTGGTGGATGAATCTGTTGGTATTTATGGGAGGGATTTTGATAAGAAGGCCATAGTCAAGCAATTGTTTGAAGCAAATGGCAACGATCTAAGCGTGATCCCCATAGTGGGTATGGGTGGGGTTGGTAAAACAACCCTTGCTCAGTATGTGTATAATGAACCCAGGGTGCAAGAGTCATTTGATCTTAAAGCATGGGTCTGTGTATCCGCAGTTTTTGATGTCTTCAAGGTAACAAAAGATATTCTTGAAGATGTCACTAGGAAGAAATGTGATATCACGACACTGAATCTCCTTCAGCTGGAGCTAAAGGAGAAGTTGAAGGGAAAAAGGTTTCTGCTTGTTTTAGATGACGTTTGGGATGATAATTATGCTAACTGGGATGTTCTGCGGAAGCCTTTGAAATCGGGGGCACTGGGCAGTAAGATAATTGTCACAACACGCCATGAAACTGTAGCGTCAATCATGGGCAATGTTCTCCATCATCATCATCTAACAGAGCTAAGCGATCATGATTGCTGGCTGTTGTTTTCGAAACATGCATTTGGTGAAGGAAATTCAGCTGCACATCCAGAGTTGGCAATACTTGGTCAAGAAATTGTGAGAAAGTGTAGAGGCTTGCCTTTAGCGGCAAAAGCACTCGGTGGGGTCTTGCGTTCTAAAAGAGATACTAAGGAGTGGGAAAGAATATTTAAAAGCCTTCTATGGGAGCTATCGAATGATGAAATTCTTCCTGCCCTAAGATTAAGCTATCATTACCTACCACCACATCTGAAGAGATGTTTTGCATATTGTGCTGTATTCCCAAAGGACTATAATTTTTCAAAGGAGGAATTAATCCTTTTGTGGAGAGCGGAAGGTTTTATAGTTCAGCCTAAAGGGAGTAGGGAAAAGGAAGATGTTGGTGCTGAGTACTTTGAAGATCTCGTATCAAGGTCCTTCTTTCAGAAATCACATCTGTATAAATCAGCTTTCGTCATGCACGACCTCATTAATGATTTAGCTAAATATGTTTCTGGGGAATTTTGCTTTCAATGGGAGAATGGCGATTCATGTGAAGTTGCCAAGAGAACTCGTCATCTGTCATATCTAAGAACAAATCATGACACCTCTGTCAAATTTGAGAGCATATATAGAGCTAAGCATTTGCGCACTCTGCGTGTGAAGTGGTCATGGTGGACTGATAGAAAGGTAAAGTATGACTTATTGCCGTCACTCAGGCGTTTGCGGGTGCTATCTCTGTTTCAGTGTGATGATGTAGTTCTGTTGCCAAATACTATTGGCAATTTGAAACATTTACGATATTTGGATCTGTCTGGAACATCGATCAAAAGGTTACCTGACTCCATAAATAGTTTGTATAACTTGGAAACTTTATTAATGTATGGGTGCCAAGATCTCATCAAATTACCAATTACCATGTCAAGTTTAATCAGTTTGTGTCATCTTGATATTAGAGAAACAAAATTGCAAGAGATGCCACTGAAGATGAGTAAACTGACGAAGCTTGAAATGTTAACTGATTTCGTTTTGGGGAAAGAGAGTGGCTCCAGTATCAAGGAACTGGGGGAGCTTCAGAATCTAAGAGGATCCCTTTGTATTTGGAATCTTCAAAATGTTGCAGATGCCCAAGATGCTATGGCAGCTAATCTGAAGAATAAAAAGCACCTTAGGATGTTAGACTTGAGATGGGACGGTGAGACTGATGATTCACTTCATGAAAGAGCCATAGTTGAGCAATTACAGCCTCATATGAATGTGGAGTCTTTGTGCATTGTTGGTTATGGGGGTACAAGATTTCCGGATTGGATAGCAAATCCTACTTTCTCACATATGGTAACCTTGGAGCTTAGTAGATGTAAATACTGCTCCTTTTTACCACCACTCGGGCAGCTAGTGTCTCTAAAATCTCTTTATATCATAGCACTTGATTCCATAGTTTCTGTTGGTCTGGAGTTCTATGGAAGTTGCACACACCCGAAGAAGCCATTTGGTTCCCTTGAAATTTTACATTTTGAAAGAATGCCACAGTGGCGCGAGTGGATTTGTCATGTAGATGAAGGGGAAAATGGAGCTTTCCCACTCCTGCAACAGCTTTACATAAACGAATGTCCCAACCTGATACAGACACTGCCCGGTAACCTTCCTTCTCTGACAACAATAAAGATTGTGGGATGTCCGCAACTTGCGGCTTCATTTCCTAGCGCTCCAGCCATCCAAAAATTGAAGTTAAAGGATGATCATCGTAATGTGCTGTTGCAGAATTTTGATTTTAGTAGTCTCAAAGTTGTAAAATTCCACTCAGTAGATCCTTTGCTTCAAGGAATGGAGAAAATTGGTGTCCTTTTCATATCGGAAGAAATTGAAGTTGGAAACTGCGATTCACTCAAGTGCTTCCCATTGGAGTTGTTCCCTGAGTTATACAGTCTTGAAATCTATAGGTGTCAAAACCTTGAGTGCATCTCTGAAGCAGAGGTAACTTCTAAAGGTCTCAATGTTCTCGAATCCATAAAAATTAGGGAGTGTCCTAAGTTAATTTCTTTCCCCAAAGGAGGTTTAAACGCCCCAAATCTGACCAGTCTTCACTTATGCGATTGTTCAAATTTGAAATCCTTGCCTGAATGTATGCACTCCCTTCTCCCTTCTCTTTATGCTTTGGCAATAAATAATTGTCCAAAACTCGAGTCATTTCCAGAAGGAGGTTTGCCCCCCAAATTATACTCACTTGTCATTGAAAGTTGTGACAAACTTGTTACTGGCCGCATGAAATGGAATTTGCAAACAATTTCTTTAAAATACTTCAGTATAAGCAAGAATGAAGATGTGGAATCTTTTCCTGAGAAGATGCTATTACCTTCTACTCTTACCTGTCTCCAAATATCCAATTTTCAAAATTTGAAATCATTGGACTATGATGGGATTCAGCATCTCACCTCTCTTACGGAACTAACAATCAGCAACTGCCCTAAGCTACAGTCTGTGACAGAACAGGAGTTGCCCTTGACTGTTACCTATCTTGACATCTGGGATCTTCAGAATCTGAAATCTCTGGACTTCAGGGGGCTCTGTTATCTTACCTCTCTTAAAGAATTGGAGATCTGGAACTGTCCTAACCTCCAGTCGATGCCAGAAGATGGGCTGCCTTCTAGTCTTGTCTGTCTTACAATCTCAAATCTTCAGAATCTGCAATCTCTGAACTTCAAGGGGCTTCAGGACCTCACTTTTCTTATAGAGTTGGATATCTTGGACTGTCCTAAGCTGGAGTCCATACCCGAAGAGGGGCTTCCCACTTCCCTTTCTTCTTTAATTATCTACAACTGTCCTTCGCTGAAACAAAGGTGTAAACAGGAGAAAGGGGAGGATTGGCCCAAAATCTCTCACATTCGCCACATAGAAATTGATGGTGATACTATGAATAAATGCTGA


Protein sequences

Name Description Sequence
Disease resistance protein RGA2, putative Disease resistance protein RGA2, putative [Ricinus communis].

MAGALIGGSFLSAFLQVLFDRMASREVLDFFKGQKLNDALLNKLKTTMISVNAVLDDAEEKQITKPAVKEWLDELKDAAYEADDLLDEIAYECLRSEVEATSQTDVDQVRNFFSNFSPFKKVKEVKLEEVSKLEEILERLELLVKQKEALGLREGIEERHSHKIPTTSLVDESVGIYGRDFDKKAIVKQLFEANGNDLSVIPIVGMGGVGKTTLAQYVYNEPRVQESFDLKAWVCVSAVFDVFKVTKDILEDVTRKKCDITTLNLLQLELKEKLKGKRFLLVLDDVWDDNYANWDVLRKPLKSGALGSKIIVTTRHETVASIMGNVLHHHHLTELSDHDCWLLFSKHAFGEGNSAAHPELAILGQEIVRKCRGLPLAAKALGGVLRSKRDTKEWERIFKSLLWELSNDEILPALRLSYHYLPPHLKRCFAYCAVFPKDYNFSKEELILLWRAEGFIVQPKGSREKEDVGAEYFEDLVSRSFFQKSHLYKSAFVMHDLINDLAKYVSGEFCFQWENGDSCEVAKRTRHLSYLRTNHDTSVKFESIYRAKHLRTLRVKWSWWTDRKVKYDLLPSLRRLRVLSLFQCDDVVLLPNTIGNLKHLRYLDLSGTSIKRLPDSINSLYNLETLLMYGCQDLIKLPITMSSLISLCHLDIRETKLQEMPLKMSKLTKLEMLTDFVLGKESGSSIKELGELQNLRGSLCIWNLQNVADAQDAMAANLKNKKHLRMLDLRWDGETDDSLHERAIVEQLQPHMNVESLCIVGYGGTRFPDWIANPTFSHMVTLELSRCKYCSFLPPLGQLVSLKSLYIIALDSIVSVGLEFYGSCTHPKKPFGSLEILHFERMPQWREWICHVDEGENGAFPLLQQLYINECPNLIQTLPGNLPSLTTIKIVGCPQLAASFPSAPAIQKLKLKDDHRNVLLQNFDFSSLKVVKFHSVDPLLQGMEKIGVLFISEEIEVGNCDSLKCFPLELFPELYSLEIYRCQNLECISEAEVTSKGLNVLESIKIRECPKLISFPKGGLNAPNLTSLHLCDCSNLKSLPECMHSLLPSLYALAINNCPKLESFPEGGLPPKLYSLVIESCDKLVTGRMKWNLQTISLKYFSISKNEDVESFPEKMLLPSTLTCLQISNFQNLKSLDYDGIQHLTSLTELTISNCPKLQSVTEQELPLTVTYLDIWDLQNLKSLDFRGLCYLTSLKELEIWNCPNLQSMPEDGLPSSLVCLTISNLQNLQSLNFKGLQDLTFLIELDILDCPKLESIPEEGLPTSLSSLIIYNCPSLKQRCKQEKGEDWPKISHIRHIEIDGDTMNKC

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF236
5-893 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

LIGGSFLSAFLQVLFDRMASREVLDFFKGQKLNDALLNKLKTTMISVNAVLDDAEEKQITKPAVKEWLDELKDAAYEADDLLDEIAYECLRSEVEATSQTDVDQVRNFFSNFSPFKKVKEVKLEEVSKLEEILERLELLVKQKEALGLREGIEERHSHKIPTTSLVDESVGIYGRDFDKKAIVKQLFEANGNDLSVIPIVGMGGVGKTTLAQYVYNEPRVQESFDLKAWVCVSAVFDVFKVTKDILEDVTRKKCDITTLNLLQLELKEKLKGKRFLLVLDDVWDDNYANWDVLRKPLKSGALGSKIIVTTRHETVASIMGNVLHHHHLTELSDHDCWLLFSKHAFGEGNSAAHPELAILGQEIVRKCRGLPLAAKALGGVLRSKRDTKEWERIFKSLLWELSNDEILPALRLSYHYLPPHLKRCFAYCAVFPKDYNFSKEELILLWRAEGFIVQPKGSREKEDVGAEYFEDLVSRSFFQKSHLYKSAFVMHDLINDLAKYVSGEFCFQWENGDSCEVAKRTRHLSYLRTNHDTSVKFESIYRAKHLRTLRVKWSWWTDRKVKYDLLPSLRRLRVLSLFQCDDVVLLPNTIGNLKHLRYLDLSGTSIKRLPDSINSLYNLETLLMYGCQDLIKLPITMSSLISLCHLDIRETKLQEMPLKMSKLTKLEMLTDFVLGKESGSSIKELGELQNLRGSLCIWNLQNVADAQDAMAANLKNKKHLRMLDLRWDGETDDSLHERAIVEQLQPHMNVESLCIVGYGGTRFPDWIANPTFSHMVTLELSRCKYCSFLPPLGQLVSLKSLYIIALDSIVSVGLEFYGSCTHPKKPFGSLEILHFERMPQWREWICHVDEGENGAFPLLQQLYINECPNLIQTLPGNLPSLTTIKIVGC

HMMPanther: PTHR23155
5-893 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LIGGSFLSAFLQVLFDRMASREVLDFFKGQKLNDALLNKLKTTMISVNAVLDDAEEKQITKPAVKEWLDELKDAAYEADDLLDEIAYECLRSEVEATSQTDVDQVRNFFSNFSPFKKVKEVKLEEVSKLEEILERLELLVKQKEALGLREGIEERHSHKIPTTSLVDESVGIYGRDFDKKAIVKQLFEANGNDLSVIPIVGMGGVGKTTLAQYVYNEPRVQESFDLKAWVCVSAVFDVFKVTKDILEDVTRKKCDITTLNLLQLELKEKLKGKRFLLVLDDVWDDNYANWDVLRKPLKSGALGSKIIVTTRHETVASIMGNVLHHHHLTELSDHDCWLLFSKHAFGEGNSAAHPELAILGQEIVRKCRGLPLAAKALGGVLRSKRDTKEWERIFKSLLWELSNDEILPALRLSYHYLPPHLKRCFAYCAVFPKDYNFSKEELILLWRAEGFIVQPKGSREKEDVGAEYFEDLVSRSFFQKSHLYKSAFVMHDLINDLAKYVSGEFCFQWENGDSCEVAKRTRHLSYLRTNHDTSVKFESIYRAKHLRTLRVKWSWWTDRKVKYDLLPSLRRLRVLSLFQCDDVVLLPNTIGNLKHLRYLDLSGTSIKRLPDSINSLYNLETLLMYGCQDLIKLPITMSSLISLCHLDIRETKLQEMPLKMSKLTKLEMLTDFVLGKESGSSIKELGELQNLRGSLCIWNLQNVADAQDAMAANLKNKKHLRMLDLRWDGETDDSLHERAIVEQLQPHMNVESLCIVGYGGTRFPDWIANPTFSHMVTLELSRCKYCSFLPPLGQLVSLKSLYIIALDSIVSVGLEFYGSCTHPKKPFGSLEILHFERMPQWREWICHVDEGENGAFPLLQQLYINECPNLIQTLPGNLPSLTTIKIVGC

Gene3D: G3DSA:3.40.50.300
119-160 G3DSA:3.40.50.300

FKKVKEVKLEEVSKLEEILERLELLVKQKEALGLREGIEERH

superfamily: SSF52540
158-408 SSF52540

ERHSHKIPTTSLVDESVGIYGRDFDKKAIVKQLFEANGNDLSVIPIVGMGGVGKTTLAQYVYNEPRVQESFDLKAWVCVSAVFDVFKVTKDILEDVTRKKCDITTLNLLQLELKEKLKGKRFLLVLDDVWDDNYANWDVLRKPLKSGALGSKIIVTTRHETVASIMGNVLHHHHLTELSDHDCWLLFSKHAFGEGNSAAHPELAILGQEIVRKCRGLPLAAKALGGVLRSKRDTKEWERIFKSLLWELSND

HMMPfam: PF00931
IPR002182
182-457 NB-ARC,NBS
NB-ARC

DKKAIVKQLFEANGNDLSVIPIVGMGGVGKTTLAQYVYNEPRVQESFDLKAWVCVSAVFDVFKVTKDILEDVTRKKCDITTLNLLQLELKEKLKGKRFLLVLDDVWDDNYANWDVLRKPLKSGALGSKIIVTTRHETVASIMGNVLHHHHLTELSDHDCWLLFSKHAFGEGNSAAHPELAILGQEIVRKCRGLPLAAKALGGVLRSKRDTKEWERIFKSLLWELSNDEILPALRLSYHYLPPHLKRCFAYCAVFPKDYNFSKEELILLWRAEGFIV

Gene3D: G3DSA:3.40.50.300
192-318 G3DSA:3.40.50.300

EANGNDLSVIPIVGMGGVGKTTLAQYVYNEPRVQESFDLKAWVCVSAVFDVFKVTKDILEDVTRKKCDITTLNLLQLELKEKLKGKRFLLVLDDVWDDNYANWDVLRKPLKSGALGSKIIVTTRHET

FPrintScan: PR00364
IPR000767
200-215 DISEASERSIST
Disease resistance protein

VIPIVGMGGVGKTTLA

FPrintScan: PR00364
IPR000767
273-287 DISEASERSIST
Disease resistance protein

KLKGKRFLLVLDDVW

FPrintScan: PR00364
IPR000767
371-385 DISEASERSIST
Disease resistance protein

CRGLPLAAKALGGVL

superfamily: SSF52058
493-894 SSF52058,LRR

VMHDLINDLAKYVSGEFCFQWENGDSCEVAKRTRHLSYLRTNHDTSVKFESIYRAKHLRTLRVKWSWWTDRKVKYDLLPSLRRLRVLSLFQCDDVVLLPNTIGNLKHLRYLDLSGTSIKRLPDSINSLYNLETLLMYGCQDLIKLPITMSSLISLCHLDIRETKLQEMPLKMSKLTKLEMLTDFVLGKESGSSIKELGELQNLRGSLCIWNLQNVADAQDAMAANLKNKKHLRMLDLRWDGETDDSLHERAIVEQLQPHMNVESLCIVGYGGTRFPDWIANPTFSHMVTLELSRCKYCSFLPPLGQLVSLKSLYIIALDSIVSVGLEFYGSCTHPKKPFGSLEILHFERMPQWREWICHVDEGENGAFPLLQQLYINECPNLIQTLPGNLPSLTTIKIVGCP

Gene3D: G3DSA:3.80.10.10
548-740 G3DSA:3.80.10.10

KHLRTLRVKWSWWTDRKVKYDLLPSLRRLRVLSLFQCDDVVLLPNTIGNLKHLRYLDLSGTSIKRLPDSINSLYNLETLLMYGCQDLIKLPITMSSLISLCHLDIRETKLQEMPLKMSKLTKLEMLTDFVLGKESGSSIKELGELQNLRGSLCIWNLQNVADAQDAMAANLKNKKHLRMLDLRWDGETDDSLH

FPrintScan: PR00364
IPR000767
595-611 DISEASERSIST
Disease resistance protein

GNLKHLRYLDLSGTSIK

ProfileScan: PS51450
IPR001611
599-620 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLRYLDLSGTSIKRLPDSINSL

Gene3D: G3DSA:3.80.10.10
777-819 G3DSA:3.80.10.10

SHMVTLELSRCKYCSFLPPLGQLVSLKSLYIIALDSIVSVGLE

Gene3D: G3DSA:3.80.10.10
851-916 G3DSA:3.80.10.10

HVDEGENGAFPLLQQLYINECPNLIQTLPGNLPSLTTIKIVGCPQLAASFPSAPAIQKLKLKDDHR

superfamily: SSF52058
914-1294 SSF52058,LRR

DHRNVLLQNFDFSSLKVVKFHSVDPLLQGMEKIGVLFISEEIEVGNCDSLKCFPLELFPELYSLEIYRCQNLECISEAEVTSKGLNVLESIKIRECPKLISFPKGGLNAPNLTSLHLCDCSNLKSLPECMHSLLPSLYALAINNCPKLESFPEGGLPPKLYSLVIESCDKLVTGRMKWNLQTISLKYFSISKNEDVESFPEKMLLPSTLTCLQISNFQNLKSLDYDGIQHLTSLTELTISNCPKLQSVTEQELPLTVTYLDIWDLQNLKSLDFRGLCYLTSLKELEIWNCPNLQSMPEDGLPSSLVCLTISNLQNLQSLNFKGLQDLTFLIELDILDCPKLESIPEEGLPTSLSSLIIYNCPSLKQRCKQEKGEDWPKISH

Gene3D: G3DSA:3.80.10.10
956-1060 G3DSA:3.80.10.10

EVGNCDSLKCFPLELFPELYSLEIYRCQNLECISEAEVTSKGLNVLESIKIRECPKLISFPKGGLNAPNLTSLHLCDCSNLKSLPECMHSLLPSLYALAINNCPK

ProfileScan: PS51450
IPR001611
1024-1046 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTSLHLCDCSNLKSLPECMHSL

ProfileScan: PS51450
IPR001611
1092-1113 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQTISLKYFSISKNEDVESFP

Gene3D: G3DSA:3.80.10.10
1097-1277 G3DSA:3.80.10.10

SLKYFSISKNEDVESFPEKMLLPSTLTCLQISNFQNLKSLDYDGIQHLTSLTELTISNCPKLQSVTEQELPLTVTYLDIWDLQNLKSLDFRGLCYLTSLKELEIWNCPNLQSMPEDGLPSSLVCLTISNLQNLQSLNFKGLQDLTFLIELDILDCPKLESIPEEGLPTSLSSLIIYNCPSL

ProfileScan: PS51450
IPR001611
1132-1151 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKSLDYDGIQHLTSLTELT

ProfileScan: PS51450
IPR001611
1180-1202 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKSLDFRGLCYLTSLKELEIWN

ProfileScan: PS51450
IPR001611
1225-1247 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQNLQSLNFKGLQDLTFLIELD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox