PRGDB00062229 (Disease resistance protein RGA2, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RGA2, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255565989 (XM_002523937)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RGA2, putative, mRNA.

DNA Sequence

ATGGGCGACGCTTATTTATCTTTAATTAACCCCTTAAGTAGCCAAATCTTGGCCCTTGTTACCTCCTTGACCAAAGACGGGTATGATCTACTTCAAGGTGTCAAGGCAGCAGCAGCAAAGCTCTCAAGCAACTTAACGGCCATTGAAGCTATGCTTAAAACGGCAGAAGAGAAACAACTGGAGGAAACCCATTTGAGTGATTGGCTTGGAAAGCTAAAAATTGCTGTCTGGGATGTAGAGGACGTATTAGAAACGTTTGAAACAGACGTCTCTCTTTGGAAGAGAAAGCAGGAGGTATGTGGCTTTAAGTCTCCTTTCAGTCTCAGTAAAACTTCCTTTGAGTATGATGCTGCTAATAGGATTAAAACAGTTACTTCAAAACTGGGACTTATTGCTGAAGAGAAAAGATTTCAACTTGATGTTAATGTTGATGTGAGGAGGCCTTTAAAAAAACTGCCCACTTCTTCTTCTTCTGTAGAGACTGCTTGTGTTTTTGGTAGGGAAGATGATAAGGAGAACATAGTAGATTTGCTGCTATCAGATGAATCTGATCAACAAAAGAATGTTTCCCTTTTCCCCATTGTCGGAATGGGAGGCCTTGGCAAAACAACTCTTGCTCGCCTTGTATATGATGATAGCAGGGTAGTGAAGCATTTTGAACTTAGGATGTGGGTCCCTGTTACAATAGACTTCAATCTTACAGAGATTATGAGAGAGATGATGCATCTGGGTTCTGATCTATCTCCATCACTAGTAGAGCTTCGCTGTCGAGAATTTTTGCGCGGAAAACGGTTTTTCCTTGTTCTAGATGACGTCTGGTCTGTGGACTACAATGATGATTGGAAGCCCCTCTTACAGCTTTTAGAAATTGCCCAGTTTGGTAGTAAAGTTTTAGTTACTACTCAAAACCAAAAGATAGCAGAGATTATAGAGACACAGCCAGCTTACTTGTTAGACTGTTTGCCTGAAAATGAATGTTGGTCATTGTTTAAGAGTATTGCATTTAGAGGTGGGAATTTGCCAAGCTTGGTGCAGAATGATTTGGAAAACATTGGCAGGGAAATTTTAAGCAAATGCAATGGTTTGCCTTTGGCAGTAAAGGGTATGGGGAATATCTTGCGTGGTAATGTTGATATAAGTAATTGGCAGAAGGTTATGAATAGCAGCGTAATGGACCTAGAGAACTCAAAAAATTCACTTAATATCTTAGCTACTATAAAATGGAGCTATTATTACCTTCCTTCTCACCTAAAGCAGTGTTTTGCATATTGCTCCATATTTCCCAAGGGCTATAAGTTTGACAAGAAAGAGCTAGTGAAACTCTGGATGGCACAAGGCTTTATTCACAGCGAGCAAGAAAGAACAGAGAAGATTGGAATGGAATATTTTGATGAGTTGTTAGCAAGCGCAGAAATTAAACTGCATGACCAAGCAGCTGAAGAGATTCTTGAAAACATGGTACCTCACACAAATATCAAGGAACTCCAAATTTGCAACTATACCGGCACTGGATTCCCAACTTGGATGAGAGATGGACTGCTTCAGAATTTGGTCATTGTCACATTAAAACATTGCACAAAATCCAAAACCCTTACTCTTGGTCAGCTACCTCATCTTGAAGCACTCAACATGGAGGGGTTGCTGGCGTTAGAGGAGTGGCCAACTGTCCGTTGCCCTTCCCTGGATAGGCTAAAGATTTGTAACTGTCCCGAGCTACGAAAGTTGCCTGACATCTTTCACAAATTAAGAACTCTGGAGATTAGAAGGTGCAACTCATTAAAGGTGCTTCCTGAAGCACCATGTCTGAAGTCTTTGATGGCTGTTGACAATCCTAATCTGGAAGACCAGAATGAAGTAATGTTGCCATCTGAATCTGAAGGGGAAATATCTTCTCTATTGAAATTAGTAGATTTGAGAATAGAAAACTGCCCCAAGTTATCAGCACTACCTGGAGTGTCGAAAAGAGCTGGAGATAAGCAAGTGTAA


Protein sequences

Name Description Sequence
Disease resistance protein RGA2, putative Disease resistance protein RGA2, putative [Ricinus communis].

MGDAYLSLINPLSSQILALVTSLTKDGYDLLQGVKAAAAKLSSNLTAIEAMLKTAEEKQLEETHLSDWLGKLKIAVWDVEDVLETFETDVSLWKRKQEVCGFKSPFSLSKTSFEYDAANRIKTVTSKLGLIAEEKRFQLDVNVDVRRPLKKLPTSSSSVETACVFGREDDKENIVDLLLSDESDQQKNVSLFPIVGMGGLGKTTLARLVYDDSRVVKHFELRMWVPVTIDFNLTEIMREMMHLGSDLSPSLVELRCREFLRGKRFFLVLDDVWSVDYNDDWKPLLQLLEIAQFGSKVLVTTQNQKIAEIIETQPAYLLDCLPENECWSLFKSIAFRGGNLPSLVQNDLENIGREILSKCNGLPLAVKGMGNILRGNVDISNWQKVMNSSVMDLENSKNSLNILATIKWSYYYLPSHLKQCFAYCSIFPKGYKFDKKELVKLWMAQGFIHSEQERTEKIGMEYFDELLASAEIKLHDQAAEEILENMVPHTNIKELQICNYTGTGFPTWMRDGLLQNLVIVTLKHCTKSKTLTLGQLPHLEALNMEGLLALEEWPTVRCPSLDRLKICNCPELRKLPDIFHKLRTLEIRRCNSLKVLPEAPCLKSLMAVDNPNLEDQNEVMLPSESEGEISSLLKLVDLRIENCPKLSALPGVSKRAGDKQV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
9-650 PTHR23155:SF121,SUBFAMILY NOT NAMED

INPLSSQILALVTSLTKDGYDLLQGVKAAAAKLSSNLTAIEAMLKTAEEKQLEETHLSDWLGKLKIAVWDVEDVLETFETDVSLWKRKQEVCGFKSPFSLSKTSFEYDAANRIKTVTSKLGLIAEEKRFQLDVNVDVRRPLKKLPTSSSSVETACVFGREDDKENIVDLLLSDESDQQKNVSLFPIVGMGGLGKTTLARLVYDDSRVVKHFELRMWVPVTIDFNLTEIMREMMHLGSDLSPSLVELRCREFLRGKRFFLVLDDVWSVDYNDDWKPLLQLLEIAQFGSKVLVTTQNQKIAEIIETQPAYLLDCLPENECWSLFKSIAFRGGNLPSLVQNDLENIGREILSKCNGLPLAVKGMGNILRGNVDISNWQKVMNSSVMDLENSKNSLNILATIKWSYYYLPSHLKQCFAYCSIFPKGYKFDKKELVKLWMAQGFIHSEQERTEKIGMEYFDELLASAEIKLHDQAAEEILENMVPHTNIKELQICNYTGTGFPTWMRDGLLQNLVIVTLKHCTKSKTLTLGQLPHLEALNMEGLLALEEWPTVRCPSLDRLKICNCPELRKLPDIFHKLRTLEIRRCNSLKVLPEAPCLKSLMAVDNPNLEDQNEVMLPSESEGEISSLLKLVDLRIENCPKLSALP

HMMPanther: PTHR23155
9-650 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

INPLSSQILALVTSLTKDGYDLLQGVKAAAAKLSSNLTAIEAMLKTAEEKQLEETHLSDWLGKLKIAVWDVEDVLETFETDVSLWKRKQEVCGFKSPFSLSKTSFEYDAANRIKTVTSKLGLIAEEKRFQLDVNVDVRRPLKKLPTSSSSVETACVFGREDDKENIVDLLLSDESDQQKNVSLFPIVGMGGLGKTTLARLVYDDSRVVKHFELRMWVPVTIDFNLTEIMREMMHLGSDLSPSLVELRCREFLRGKRFFLVLDDVWSVDYNDDWKPLLQLLEIAQFGSKVLVTTQNQKIAEIIETQPAYLLDCLPENECWSLFKSIAFRGGNLPSLVQNDLENIGREILSKCNGLPLAVKGMGNILRGNVDISNWQKVMNSSVMDLENSKNSLNILATIKWSYYYLPSHLKQCFAYCSIFPKGYKFDKKELVKLWMAQGFIHSEQERTEKIGMEYFDELLASAEIKLHDQAAEEILENMVPHTNIKELQICNYTGTGFPTWMRDGLLQNLVIVTLKHCTKSKTLTLGQLPHLEALNMEGLLALEEWPTVRCPSLDRLKICNCPELRKLPDIFHKLRTLEIRRCNSLKVLPEAPCLKSLMAVDNPNLEDQNEVMLPSESEGEISSLLKLVDLRIENCPKLSALP

superfamily: SSF52540
146-395 SSF52540

RRPLKKLPTSSSSVETACVFGREDDKENIVDLLLSDESDQQKNVSLFPIVGMGGLGKTTLARLVYDDSRVVKHFELRMWVPVTIDFNLTEIMREMMHLGSDLSPSLVELRCREFLRGKRFFLVLDDVWSVDYNDDWKPLLQLLEIAQFGSKVLVTTQNQKIAEIIETQPAYLLDCLPENECWSLFKSIAFRGGNLPSLVQNDLENIGREILSKCNGLPLAVKGMGNILRGNVDISNWQKVMNSSVMDLEN

Gene3D: G3DSA:3.40.50.300
165-313 G3DSA:3.40.50.300

FGREDDKENIVDLLLSDESDQQKNVSLFPIVGMGGLGKTTLARLVYDDSRVVKHFELRMWVPVTIDFNLTEIMREMMHLGSDLSPSLVELRCREFLRGKRFFLVLDDVWSVDYNDDWKPLLQLLEIAQFGSKVLVTTQNQKIAEIIETQ

HMMPfam: PF00931
IPR002182
167-452 NB-ARC,NBS
NB-ARC

REDDKENIVDLLLSDESDQQKNVSLFPIVGMGGLGKTTLARLVYDDSRVVKHFELRMWVPVTIDFNLTEIMREMMHLGSDLSPSLVELRCREFLRGKRFFLVLDDVWSVDYNDDWKPLLQLLEIAQFGSKVLVTTQNQKIAEIIETQPAYLLDCLPENECWSLFKSIAFRGGNLPSLVQNDLENIGREILSKCNGLPLAVKGMGNILRGNVDISNWQKVMNSSVMDLENSKNSLNILATIKWSYYYLPSHLKQCFAYCSIFPKGYKFDKKELVKLWMAQGFIHSEQ

FPrintScan: PR00364
IPR000767
191-206 DISEASERSIST
Disease resistance protein

LFPIVGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
259-273 DISEASERSIST
Disease resistance protein

FLRGKRFFLVLDDVW

FPrintScan: PR00364
IPR000767
359-373 DISEASERSIST
Disease resistance protein

CNGLPLAVKGMGNIL

Gene3D: G3DSA:3.80.10.10
456-645 G3DSA:3.80.10.10

EKIGMEYFDELLASAEIKLHDQAAEEILENMVPHTNIKELQICNYTGTGFPTWMRDGLLQNLVIVTLKHCTKSKTLTLGQLPHLEALNMEGLLALEEWPTVRCPSLDRLKICNCPELRKLPDIFHKLRTLEIRRCNSLKVLPEAPCLKSLMAVDNPNLEDQNEVMLPSESEGEISSLLKLVDLRIENCPK

superfamily: SSF52058
483-650 SSF52058,LRR

LENMVPHTNIKELQICNYTGTGFPTWMRDGLLQNLVIVTLKHCTKSKTLTLGQLPHLEALNMEGLLALEEWPTVRCPSLDRLKICNCPELRKLPDIFHKLRTLEIRRCNSLKVLPEAPCLKSLMAVDNPNLEDQNEVMLPSESEGEISSLLKLVDLRIENCPKLSALP

FPrintScan: PR00364
IPR000767
577-593 DISEASERSIST
Disease resistance protein

DIFHKLRTLEIRRCNSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox