PRGDB00062231 (Disease resistance protein RGA2, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RGA2, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255563928 (XM_002522918)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RGA2, putative, mRNA.

DNA Sequence

ATGGCAGCTGAGAGAATTGGTGTCACAGTTGGTGTCACTTTTGCTACCAAGATTACAGAACTCTTGGCGAACCCAACTAGACGTCAACTTCGATATGTGTTTTGCTTCAACAGTATTGTTGAAGAACTTAAGAAAGAAGAGAAGAATCTGATGCTAGCGCGAGATCGGGTGCAAAACAAAGTCAACATGGCCTTAAGAAATGCTGAAGAAATCGAGAAAGATGTAGAAGAGTGGATGACAGAAACAAACACAGTCATCGACGATGTTCAGCGGCTTAAAATTGAGATTGAGAAGTATATGAAGTACTTCGACAAGTGGTGTTCTAGTTGGATCTGGCGATACAGTTTCAACAAGAAAGTGGCAAAAAAGGCAGTGATTCTTAGAAGGCTCTGGGAAAGTGGCAAATTTGATACAGTGTCCTATCAAGCTCCACTTTCAGGCACAGAATTTTTTCCGTCCAAGGATTTTACTCCTTCAAAATCTTCAAGAAAAGCTTTGAACCAGATTATGGTGGCTGTGAAGGATGATGATGTCAACATGATTGGCCTGTATGGTATGGGAGGGGTGGGTAAGACCACCTTAGTTAAAGAAGCTAGCAGAAAAGCCACTATGTTGAAGCTTTTTGATCAAGTTCTGATGGTTGTGGTGTCCCAAGCTCAAGATGTCATAAAGATCCAAGATCAAATGGCAGACAAGTTAGGTTTGAATTTTGATGTAAAGACTACCGAGGGAAGAGCAAGACGATTGCATAAGAGATTGAAGAATGAGAAGAAGATACTTATAATCCTGGATGATGTTTGGAGATATCTTGACTTGAAAGATATAGGGATCCCACATGGTGACGATCACAAGGGCTGTAAAATTCTCCTAACAACACGTCTACGGCGTGTCTGTGCTTCTCTAAACTGTCAAAGAGATATTCCTTTGCATGTTTTAACTGAAAGTGAAGCATGGGCTTTGTTCAAGAATATTGCAGGTCTACATGATTGCTCCTCTGACTTGAACAATGTGGCAGTGAAAGTTGTAAGAAAATGCAAAGGTTTGCCTTTGGCGATTGTGACTGTAGGGAGGGCTCTAAGAGATAAAAGCTTTAGTGGATGGAAAGTAGCTCTTCAAAAACTTAAAAGTTCTAGACTCATAGACATTCGGGATGTTGACAAAGACAAAAATGCTTATGCATGTCTGAAGTTGAGTTTTGATCATTTGCAGTGTGAAGAAACCAAGTTGTGCCTGCTGTTGTGCTCTCTCTTTCCAGAAGACTATGAAATATTCGTTGAGGACTTGGCTAGATATGCAGTTGGGTTGGGGTTCTATCAAGATGCTCAATCGATAGATGATGTACGGAGTGAAGTGTTTGAGGCAATTGGTGACCTCAAAGCTTCTTGTCTGTTGTTGGAAACTGAAAGTGAAGGACACGTGAAATTGCATGACATGGTTCGTGATTTTGCCTTATGGGTTGGATCCAGAGTGGAACAAGCATTTAGAGTGAGAGCCAGAGTTGGTTTGGAAGAATGGCCAAAGACTGGAAACTCTGACAGTTATACTGCTATGTCCTTGATGAACAACAATGTAAGAGAACTTCCTGCCAGATTGGTTTGTCCAAAACTTCAACTGTTGTTATTGGCCAGAAAAAGAGCATTATTTTGCAGAGAAGAAACTATCACTGTTCCGGATACAGTATTTGAAGGAGTGAAAGAACTTAAAGTTTTATCTTTAGCCCATGGATTCTTGTCAATGCAATCTTTAGAATTTCTAACAAATCTTCAGACCTTAGAGCTCAAATATTGCTATATCAATTGGCCCCGCTCAGGGAAGAAAAGAACTGACCTTGCTTTATTTCAGATGCTAAAACGACTCAAGATTCTTAGCTTCTTTGGTTCTTTTATTGAAGAATTGCCTGAAGAAATTGGAGAACTGGATAATCTAAGAGTGTTGGATTTGAGAAGTTGTAAATTGCTGGTGAGAATTCCCTCGAATCTGATTCGGAGGTTATCCAAACTGGAAGAGTTATACATCGGTAGCTCTAGCTTTAAGAAATGGGAAGTTGAGGGTACATGCAAACAAGGAAGCAATGCTAGCTTGATGGAGCTGAAGTCACTATCTCACTTGGACACTGTATGGTTGAACTATGATGAGTTCATCCAGAAGGACTTTGCTTTCCCCAATTTGAATGGGTATTACGTGCACATAAATTGTGGATGCACCTCTGATTCATCCCCATCAGGTAGCTATCCTACCTCAAGAACAATATGCTTGGGGCCTACCGGTGTCACGACATTGAAGGCATGCAAGGAGTTGTTCCAGAATGTATATGATCTTCATTTGCTCAGCAGCACAAATTTCTGCAACATTCTCCCAGAGATGGATGGAAGGGGCTTTAACGAGTTAGCCTCCCTTAAGCTCCTTTTATGCGACTTTGGGTGCCTCGTGGACACTAAGCAACGGCAAGCACCAGCAATTGCATTCTCAAATTTAAAGGTGATAGACATGTGCAAAACAGGTCTCAGAAAAATATGTCATGGTCTGCCACCAGAGGGGTTCCTAGAAAAATTACAAACACTTAAGTTGTATGGCTGCTACCATATGGTTCAGATATTTCCTGCAAAGTTGTGGAAAACATTACAGACTCTGGAAAAGGTCATTGTTCGTCGTTGTAGTGATTTGCAAGAAGTATTCGAGCTCCACAGACTCAACGAAGTAAATGCTAATTTGCTTTCTTGTTTAACAACATTAGAACTTCAGGAGTTACCTGAACTGAGGAGCATATGGAAGGGCCCCACCCATAATGTAAGTCTGAAGAATCTCACTCATTTAATCTTGAATAACTGCAGGTGTCTGACATCTGTTTTCTCACCGTCCCTTGCTCAAAGTCTGGTGCACATAAGAACAATCTATATAGGATGTTGTGACCAGATCAAGCATATTATCGCAGAGAAGGTTGAGGATGGGGAGAAAACATTTTCGAAACTCCATCTCCAACCACTTAGCCTACGTAACTTGCAGACTCTCACAATATACGAGTGCAATAGATTGGAATACATATTCCCAATATCTATTGCTCGAGGCTTTATGCGCCTGGAAAAAATTATTATAGTGCGCGCAGTTCAGTTAGCGGAATTCTTCAGGACTGGAGAGCAAGTTATACTTTCTCCAGGTGGGAATAATAGCATGTCTCTTCAGCAAAAGAATTTGGAACTCAAATGTTCATCACCGCATAGCTGCTGCTCAGGGGATCATACTGCGGTTTTTCCATCTTTGCAACATCTTGAATTTACGGGCTGCCCAAAGCTATTGATTCATTCCATTGCTGAACTTTTGGTTCCTTCAAAGGTATATTTTACATAA


Protein sequences

Name Description Sequence
Disease resistance protein RGA2, putative Disease resistance protein RGA2, putative [Ricinus communis].

MAAERIGVTVGVTFATKITELLANPTRRQLRYVFCFNSIVEELKKEEKNLMLARDRVQNKVNMALRNAEEIEKDVEEWMTETNTVIDDVQRLKIEIEKYMKYFDKWCSSWIWRYSFNKKVAKKAVILRRLWESGKFDTVSYQAPLSGTEFFPSKDFTPSKSSRKALNQIMVAVKDDDVNMIGLYGMGGVGKTTLVKEASRKATMLKLFDQVLMVVVSQAQDVIKIQDQMADKLGLNFDVKTTEGRARRLHKRLKNEKKILIILDDVWRYLDLKDIGIPHGDDHKGCKILLTTRLRRVCASLNCQRDIPLHVLTESEAWALFKNIAGLHDCSSDLNNVAVKVVRKCKGLPLAIVTVGRALRDKSFSGWKVALQKLKSSRLIDIRDVDKDKNAYACLKLSFDHLQCEETKLCLLLCSLFPEDYEIFVEDLARYAVGLGFYQDAQSIDDVRSEVFEAIGDLKASCLLLETESEGHVKLHDMVRDFALWVGSRVEQAFRVRARVGLEEWPKTGNSDSYTAMSLMNNNVRELPARLVCPKLQLLLLARKRALFCREETITVPDTVFEGVKELKVLSLAHGFLSMQSLEFLTNLQTLELKYCYINWPRSGKKRTDLALFQMLKRLKILSFFGSFIEELPEEIGELDNLRVLDLRSCKLLVRIPSNLIRRLSKLEELYIGSSSFKKWEVEGTCKQGSNASLMELKSLSHLDTVWLNYDEFIQKDFAFPNLNGYYVHINCGCTSDSSPSGSYPTSRTICLGPTGVTTLKACKELFQNVYDLHLLSSTNFCNILPEMDGRGFNELASLKLLLCDFGCLVDTKQRQAPAIAFSNLKVIDMCKTGLRKICHGLPPEGFLEKLQTLKLYGCYHMVQIFPAKLWKTLQTLEKVIVRRCSDLQEVFELHRLNEVNANLLSCLTTLELQELPELRSIWKGPTHNVSLKNLTHLILNNCRCLTSVFSPSLAQSLVHIRTIYIGCCDQIKHIIAEKVEDGEKTFSKLHLQPLSLRNLQTLTIYECNRLEYIFPISIARGFMRLEKIIIVRAVQLAEFFRTGEQVILSPGGNNSMSLQQKNLELKCSSPHSCCSGDHTAVFPSLQHLEFTGCPKLLIHSIAELLVPSKVYFT

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF108
11-1097 PTHR23155:SF108,SUBFAMILY NOT NAMED

GVTFATKITELLANPTRRQLRYVFCFNSIVEELKKEEKNLMLARDRVQNKVNMALRNAEEIEKDVEEWMTETNTVIDDVQRLKIEIEKYMKYFDKWCSSWIWRYSFNKKVAKKAVILRRLWESGKFDTVSYQAPLSGTEFFPSKDFTPSKSSRKALNQIMVAVKDDDVNMIGLYGMGGVGKTTLVKEASRKATMLKLFDQVLMVVVSQAQDVIKIQDQMADKLGLNFDVKTTEGRARRLHKRLKNEKKILIILDDVWRYLDLKDIGIPHGDDHKGCKILLTTRLRRVCASLNCQRDIPLHVLTESEAWALFKNIAGLHDCSSDLNNVAVKVVRKCKGLPLAIVTVGRALRDKSFSGWKVALQKLKSSRLIDIRDVDKDKNAYACLKLSFDHLQCEETKLCLLLCSLFPEDYEIFVEDLARYAVGLGFYQDAQSIDDVRSEVFEAIGDLKASCLLLETESEGHVKLHDMVRDFALWVGSRVEQAFRVRARVGLEEWPKTGNSDSYTAMSLMNNNVRELPARLVCPKLQLLLLARKRALFCREETITVPDTVFEGVKELKVLSLAHGFLSMQSLEFLTNLQTLELKYCYINWPRSGKKRTDLALFQMLKRLKILSFFGSFIEELPEEIGELDNLRVLDLRSCKLLVRIPSNLIRRLSKLEELYIGSSSFKKWEVEGTCKQGSNASLMELKSLSHLDTVWLNYDEFIQKDFAFPNLNGYYVHINCGCTSDSSPSGSYPTSRTICLGPTGVTTLKACKELFQNVYDLHLLSSTNFCNILPEMDGRGFNELASLKLLLCDFGCLVDTKQRQAPAIAFSNLKVIDMCKTGLRKICHGLPPEGFLEKLQTLKLYGCYHMVQIFPAKLWKTLQTLEKVIVRRCSDLQEVFELHRLNEVNANLLSCLTTLELQELPELRSIWKGPTHNVSLKNLTHLILNNCRCLTSVFSPSLAQSLVHIRTIYIGCCDQIKHIIAEKVEDGEKTFSKLHLQPLSLRNLQTLTIYECNRLEYIFPISIARGFMRLEKIIIVRAVQLAEFFRTGEQVILSPGGNNSMSLQQKNLELKCSSPHSCCSGDHTAVFPSLQHLEFTGCPKL

HMMPanther: PTHR23155
11-1097 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GVTFATKITELLANPTRRQLRYVFCFNSIVEELKKEEKNLMLARDRVQNKVNMALRNAEEIEKDVEEWMTETNTVIDDVQRLKIEIEKYMKYFDKWCSSWIWRYSFNKKVAKKAVILRRLWESGKFDTVSYQAPLSGTEFFPSKDFTPSKSSRKALNQIMVAVKDDDVNMIGLYGMGGVGKTTLVKEASRKATMLKLFDQVLMVVVSQAQDVIKIQDQMADKLGLNFDVKTTEGRARRLHKRLKNEKKILIILDDVWRYLDLKDIGIPHGDDHKGCKILLTTRLRRVCASLNCQRDIPLHVLTESEAWALFKNIAGLHDCSSDLNNVAVKVVRKCKGLPLAIVTVGRALRDKSFSGWKVALQKLKSSRLIDIRDVDKDKNAYACLKLSFDHLQCEETKLCLLLCSLFPEDYEIFVEDLARYAVGLGFYQDAQSIDDVRSEVFEAIGDLKASCLLLETESEGHVKLHDMVRDFALWVGSRVEQAFRVRARVGLEEWPKTGNSDSYTAMSLMNNNVRELPARLVCPKLQLLLLARKRALFCREETITVPDTVFEGVKELKVLSLAHGFLSMQSLEFLTNLQTLELKYCYINWPRSGKKRTDLALFQMLKRLKILSFFGSFIEELPEEIGELDNLRVLDLRSCKLLVRIPSNLIRRLSKLEELYIGSSSFKKWEVEGTCKQGSNASLMELKSLSHLDTVWLNYDEFIQKDFAFPNLNGYYVHINCGCTSDSSPSGSYPTSRTICLGPTGVTTLKACKELFQNVYDLHLLSSTNFCNILPEMDGRGFNELASLKLLLCDFGCLVDTKQRQAPAIAFSNLKVIDMCKTGLRKICHGLPPEGFLEKLQTLKLYGCYHMVQIFPAKLWKTLQTLEKVIVRRCSDLQEVFELHRLNEVNANLLSCLTTLELQELPELRSIWKGPTHNVSLKNLTHLILNNCRCLTSVFSPSLAQSLVHIRTIYIGCCDQIKHIIAEKVEDGEKTFSKLHLQPLSLRNLQTLTIYECNRLEYIFPISIARGFMRLEKIIIVRAVQLAEFFRTGEQVILSPGGNNSMSLQQKNLELKCSSPHSCCSGDHTAVFPSLQHLEFTGCPKL

superfamily: SSF52540
165-382 SSF52540

ALNQIMVAVKDDDVNMIGLYGMGGVGKTTLVKEASRKATMLKLFDQVLMVVVSQAQDVIKIQDQMADKLGLNFDVKTTEGRARRLHKRLKNEKKILIILDDVWRYLDLKDIGIPHGDDHKGCKILLTTRLRRVCASLNCQRDIPLHVLTESEAWALFKNIAGLHDCSSDLNNVAVKVVRKCKGLPLAIVTVGRALRDKSFSGWKVALQKLKSSRLIDI

Gene3D: G3DSA:3.40.50.300
167-268 G3DSA:3.40.50.300

NQIMVAVKDDDVNMIGLYGMGGVGKTTLVKEASRKATMLKLFDQVLMVVVSQAQDVIKIQDQMADKLGLNFDVKTTEGRARRLHKRLKNEKKILIILDDVWR

HMMPfam: PF00931
IPR002182
174-440 NB-ARC,NBS
NB-ARC

KDDDVNMIGLYGMGGVGKTTLVKEASRKATMLKLFDQVLMVVVSQAQDVIKIQDQMADKLGLNFDVKTTEGRARRLHKRLKNEKKILIILDDVWRYLDLKDIGIPHGDDHKGCKILLTTRLRRVCASLNCQRDIPLHVLTESEAWALFKNIAGLHDCSSDLNNVAVKVVRKCKGLPLAIVTVGRALRDKSFSGWKVALQKLKSSRLIDIRDVDKDKNAYACLKLSFDHLQCEETKLCLLLCSLFPEDYEIFVEDLARYAVGLGFYQD

HMMSmart: SM00382
IPR003593
177-313 AAA,NBS
ATPase, AAA+ type, core

DVNMIGLYGMGGVGKTTLVKEASRKATMLKLFDQVLMVVVSQAQDVIKIQDQMADKLGLNFDVKTTEGRARRLHKRLKNEKKILIILDDVWRYLDLKDIGIPHGDDHKGCKILLTTRLRRVCASLNCQRDIPLHVLT

FPrintScan: PR00364
IPR000767
180-195 DISEASERSIST
Disease resistance protein

MIGLYGMGGVGKTTLV

FPrintScan: PR00364
IPR000767
253-267 DISEASERSIST
Disease resistance protein

LKNEKKILIILDDVW

FPrintScan: PR00364
IPR000767
345-359 DISEASERSIST
Disease resistance protein

CKGLPLAIVTVGRAL

superfamily: SSF52058
499-929 SSF52058,LRR

RVGLEEWPKTGNSDSYTAMSLMNNNVRELPARLVCPKLQLLLLARKRALFCREETITVPDTVFEGVKELKVLSLAHGFLSMQSLEFLTNLQTLELKYCYINWPRSGKKRTDLALFQMLKRLKILSFFGSFIEELPEEIGELDNLRVLDLRSCKLLVRIPSNLIRRLSKLEELYIGSSSFKKWEVEGTCKQGSNASLMELKSLSHLDTVWLNYDEFIQKDFAFPNLNGYYVHINCGCTSDSSPSGSYPTSRTICLGPTGVTTLKACKELFQNVYDLHLLSSTNFCNILPEMDGRGFNELASLKLLLCDFGCLVDTKQRQAPAIAFSNLKVIDMCKTGLRKICHGLPPEGFLEKLQTLKLYGCYHMVQIFPAKLWKTLQTLEKVIVRRCSDLQEVFELHRLNEVNANLLSCLTTLELQELPELRSIWKGPTHN

Gene3D: G3DSA:3.80.10.10
502-705 G3DSA:3.80.10.10

LEEWPKTGNSDSYTAMSLMNNNVRELPARLVCPKLQLLLLARKRALFCREETITVPDTVFEGVKELKVLSLAHGFLSMQSLEFLTNLQTLELKYCYINWPRSGKKRTDLALFQMLKRLKILSFFGSFIEELPEEIGELDNLRVLDLRSCKLLVRIPSNLIRRLSKLEELYIGSSSFKKWEVEGTCKQGSNASLMELKSLSHLDT

FPrintScan: PR00364
IPR000767
637-653 DISEASERSIST
Disease resistance protein

GELDNLRVLDLRSCKLL

HMMPfam: PF00560
IPR001611
641-662 LRR_1
Leucine-rich repeat

NLRVLDLRSCKLLVRIPSNLIR

Gene3D: G3DSA:3.80.10.10
821-935 G3DSA:3.80.10.10

AFSNLKVIDMCKTGLRKICHGLPPEGFLEKLQTLKLYGCYHMVQIFPAKLWKTLQTLEKVIVRRCSDLQEVFELHRLNEVNANLLSCLTTLELQELPELRSIWKGPTHNVSLKNL

Gene3D: G3DSA:3.80.10.10
936-1022 G3DSA:3.80.10.10

THLILNNCRCLTSVFSPSLAQSLVHIRTIYIGCCDQIKHIIAEKVEDGEKTFSKLHLQPLSLRNLQTLTIYECNRLEYIFPISIARG

Gene3D: G3DSA:3.80.10.10
1082-1096 G3DSA:3.80.10.10

VFPSLQHLEFTGCPK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox