PRGDB00062233 (Disease resistance protein RPS5, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RPS5, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255563251 (XM_002522583)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RPS5, putative, mRNA.

DNA Sequence

ATGGCTCTGGATGTGATTCTTGCAATTGTTCCCACTATTTTTGAGTATACTTTTGTACCCATCAAAAGACACCTGGGCTATGCTTTTAATTACAAGAGTCAAGTTGAAAACTTCAAGAATTGGACCGAGAAGTTGGTCAGTGCAAGAGAGAGACTGCAGCATTCTGTTGATTATGCTGTGAGAGGTGGGGAAGAGATTGAGAATGATGTTAAGAGGTGGATAATTGGGGTAGATAAGGCAATTGAAGAAGCTGATAAGCTTATCAAAGATGATCAAGAAGAAGCAACGAAGAGGTGTTTCATTGGACTGTGTCCTAATGTTAAGGCTCGTTACAATCTTTGCAAGAAAATGGAGAAGTATAGTAAGGTTATTGCTGAGCTACAGAATAAAGGAAGATTTGATCCAGTTTCCTACCGTGTGCAGCTACAGCAGATAGTTACTTCATCTGTTAAAAATAGAGGGGCGCTGCATTCGAGAATGTCAGTTTTGAAAGAAGTAATGGATGCATTGGCAGACCCTAATGTTCTTATGGTTGGGGTGTGTGGCATGGGTGGTGTTGGTAAAACCACTCTAGCAAAGGAGGTGCACCAACAAGTTATAGAAGAAAAATTATTTGATATAGTGGTCATGGCTACTGTATCTGAAAAGCCAGATATCAGAAAGATTCAAGGAAACATTGCTGATGTGTTGGGGTTAAAATTTGATGAGGAAACTGAAACTGGAAGAGCCTATCGACTACGTCAGAGGTTAATGACAGAGAAGAAGATTCTTGTAATACTAGATAACATTTGGGCACAACTTGAATTGGAGGAAGTAGGAATTCCATGCGGGGTTGATCACAAAGGATGCAAAATATTACTGACCTCAAGAAGTAGAGATTTATTATCGTGTGACATGGGTGTACAGAAAGTTTTCAGACTTGAAGTTTTACAGGAAGAAGAGGCCTTGAGCTTATTTGAGATGATGGTGGGTGATGTCAAAGGTGGGGAATTTCAATCCGCAGCAAGTGAAGTCACTAAAAAATGTGCAGGTTTGCCTGTTTTGATCGTGACAATTGCAAGGGCTTTAAAAAATAAGGACTTGTATGTGTGGAAGGATGCTGTGAAGCAGCTCTCTAGGTGTGACAATGAAGAAATACAGGAAAAAGTTTACTCAGCTTTAGAGCTGAGTTACAATCATTTAATCGGTGCTGAGGTCAAGTCACTTTTCTTGCTTTGCGGTTTGCTAGGAAAGTCTGATATTGCAATCCTAGATTTGTTGATGTACAGTACGGGTCTGGGTTTATTTAAAGGCATTGATACATTGGGGGATGCAAGAAACAGAGTGCACAAACTGATCAGTGACCTCAAAGCCGCTTGCTTGTTGCTAGATAGTGACATCAAGGGGCGGGTGAAAATCCATGATGTTGTACGAGATGTTGCCATCTCCATTGCATCAAGAATGCAGCATCTGTTCACCGTCAGAAATGGTGCTCTTTTGAAGGAATGGCCAAACAAGGATGTGTGTAAAAGCTGCACAAGAATTTCTCTGCCGTACAATGATATCCATGGGCTTCCTGAAGTGTTGGAATGCCCAGAATTAGAGTTATTTTTGCTTTTCACTCAAGACATTTCTCTAAAAGTACCTGATTTATGTTTTGAATTGACAAAAAACCTCAGAGTATTGAACTTTACAGGAATGCATTTTTCATCTCTTCCTCCATCATTGGGTTTCCTAAAAAACCTTTTCACCTTGTGCTTGGATTGGTGTGCACTGCGTGATGTAGCTATCATCGGAGAGCTGACAGGATTGACAATTCTTAGCTTCAAGCACTCTGATATTGTTGAGTTGCCTAGAGAAATAAGACAATTGACTAAGCTAAAGTTCTTAGATTTGAGTCATTGTTTGAAGCTCAAAGTTATTCCTGCAAAAATCATATCAGAGTTGACTCAATTAGAAGAACTATATATGAATAATAGCTTTGATCTATGGGATGTTCAAGGGATCAACAATCAACGTAATGCAAGCCTTGCAGAGCTGGAATGCTTGCCTTATTTGACAACTTTGGAAATATGCGTTCTTGACGCCAAAATACTACCAAAAGATCTGTTCTTCAGAAAATTGGAAAGATTTAGGATATTCATAGGAGACGTGTGGAGTGGAACTGGTGATTATGGAACCTCAAGAACACTTAAGCTGAAGCTCAATACAAGCAGCATCCATTTGGAGCATGGGCTTAGCATATTGCTGGAAGTAACAGAAGATTTGTACTTAGCTGAAGTGAAAGGGATTAAAAGTGTCTTATATGATCTGGATAGCCAAGGATTTACACAACTGAAGCATCTAGATGTCCAAAATGATCCTGAAATACAATATATAATTGACCCCAACAGGCGGTCTCCATGTAATGCCTTTCCCATCCTAGAATCCTTGTATCTGGACAACTTGATGAGCTTGGAGAAGATTTGTTGTGGGAAACTCACAACAGGGTCGTTCAGCAAATTAAGATCATTAACTGTTGTAAAATGTGACAGATTAAAGAATCTTTTTTCATTTTCCATGATGAGGTGCCTTTTGCAACTTCAGCAAATGAAAGTAGTTGATTGTGCTAACCTGGAAGAGATTGTTGCTTGTGGGAGTGAAGACACAGACAATGACTATGAAGCAGTCAAGCTCACTCAATTATGCTCCCTAACATTAAAGCGTCTACCAATGTTCAAAAGCTTTTGCTCTAAGAAAAAGGTGTCTCCCATATCTCTAAGAGTACAAAAGCAATTGACAACTGATACAGGGTTGAAGGAAATTGCGCCAAAGGGTGAGCTTGGTGATCCGTTGCCACTGTTCAATGAAATGTTTTGCTTTCCAAATTTGGAGAACCTGGAATTATCATCAATTGCCTGTGAAAAGATATGCGACGACCAGCTTTCTGCAATATCTTCAAACTTAATGAGCTTGATTGTGGAGCGCTGCTGGAATTTGAAGTATTTATTTACGTCTTCATTAGTTAAAAATCTTTTGCTGCTGAAAAGACTTGAGGTCTTTGATTGTATGTCCGTGGAAGGGATAATAGTTGCAGAAGAACTTGTAGAAGAAGAGAGGAACAGAAAAAAACTATTCCCAGAACTAGACTTCTTGAAGCTCAAGAATCTGCCACATATCACAAGGTTCTGTGATGGATATCCAGTTGAATTCAGTTCTCTGAGGAAATTGTTGATCGAGAATTGCCCTGCATTGAATATGTTCGTATCAAAATCACCAAGTGCAGACATGATCGAAAGCAGAGAAGCAAAGGGCATGAACTCAGAGAAGAACCACCATACAGAAACTCAACCTCTCTTCAATGAAAAGGTTGCATTCCCTAGCTTGGAAGAAATAGAACTCTCCTACATTGATAACTTAAGAAGGATATGGCACAACCAACTTGATGCAGGTTCCTTTTGCAAACTGAAAATAATGAGGATAAATGGTTGTAAAAAGTTACGGACTATTTTTCCTTCTTATCTGTTGGAAAGATTCCAGTGTTTAGAGAAGTTGTCATTAAGTGATTGTTATGCACTAGAAGAGATATATGAACTCCAAGGGCTGAATTTTAAAGAAAAACATTTATTAGCAACATCTGGGCTGAGAGAATTGTACATACGTTCTTTACCTCAGCTGAAAAGTATATTGAGTAAGGATCCACAAGGGAACTTTACCTTCCTAAACCTCCGCCTTGTAGACATTTCATATTGTTCGATGAAAAACCTTTTTCCAGCCTCCGTGGCCACTGGTCTTTTGCAACTTGAGAAGCTGGTGATAAACCATTGTTTTTGGATGGAGGAGATTTTTGCAAAAGAAAAAGGTGGAGAAACAGCCCCTAGTTTTGTATTCTTGCAACTAACCTCTTTGGAGCTTTCAGACCTTCCAAACTTTAGGAGACCAGGTGGAGAAGGCCAATTCAGTGTCCCAACCCAATCACCCATCCCCTCGATGGAAAAGGGTGAGCTTGGCATTTCTCCTTCACAATGCTGTATGGATGAACTGCGCCTGGAGCCAATTGAAAATATACCTGGAGACATATGTGAGAATGATCCTGATGATGGTTTAAGTTCAATGTTTCAAGGAGAGATGCTCCAGCAGCTAAATAACAATAACTTTCCTGAATTTTCTGATAGAAATGCTGGTAACCCTCCCTCCACTAGTTCATCAGACAAAAGTAATGCAAATGCGAGAGAAGAAGGAATGGCTATGCACTTGCGTCATCCTACCAGCACACATGTAGAGGAGCCTGGCATTGAGGGCATTCAGATTATTGGTGATGCTATACCTGGAGAAAGACTCATTGGATGTGGATATCCTGTAGGTGGAACTTCTCTTTGCATGTTTCAGTGGGTTCGTCATCTTGAGGATGGTTCTAAGCAGTACATTGTAGGAGCCACAGAGCCACATTATGTTGTCACAGCTGATGATGTTGATAAGTTGATTTCTGTTGAGTGCATACCACTGGATGACCAGGGACATCAGGGAAAACTAATGAGGCTTTTTGCAAATGACCAAAAAAAAATACAATGTGACGCAGGTATGCAAAGGAAGATTGACACCTATTCATCAATATGTGAAGCAACATTTGGTGTTCTATTGATGATGGACTCTTTTGACAATTGGGAGCCAGCAAATCTAGTGCTGCGACAAGCAGGCTACCAAATTAAGGGCAAGAGTGAAGAAAATGTGGTAATTGCAGAGAAATTCTCAAAGGAGCTATTGATTAAAATTCCTTATGGGCTTTCAAAACAGTTTATTTTAGAATGTTTCGATGGATCTTCTCATACCCTCAGTACATATGATAGCCGGTAA


Protein sequences

Name Description Sequence
Disease resistance protein RPS5, putative Disease resistance protein RPS5, putative [Ricinus communis].

MALDVILAIVPTIFEYTFVPIKRHLGYAFNYKSQVENFKNWTEKLVSARERLQHSVDYAVRGGEEIENDVKRWIIGVDKAIEEADKLIKDDQEEATKRCFIGLCPNVKARYNLCKKMEKYSKVIAELQNKGRFDPVSYRVQLQQIVTSSVKNRGALHSRMSVLKEVMDALADPNVLMVGVCGMGGVGKTTLAKEVHQQVIEEKLFDIVVMATVSEKPDIRKIQGNIADVLGLKFDEETETGRAYRLRQRLMTEKKILVILDNIWAQLELEEVGIPCGVDHKGCKILLTSRSRDLLSCDMGVQKVFRLEVLQEEEALSLFEMMVGDVKGGEFQSAASEVTKKCAGLPVLIVTIARALKNKDLYVWKDAVKQLSRCDNEEIQEKVYSALELSYNHLIGAEVKSLFLLCGLLGKSDIAILDLLMYSTGLGLFKGIDTLGDARNRVHKLISDLKAACLLLDSDIKGRVKIHDVVRDVAISIASRMQHLFTVRNGALLKEWPNKDVCKSCTRISLPYNDIHGLPEVLECPELELFLLFTQDISLKVPDLCFELTKNLRVLNFTGMHFSSLPPSLGFLKNLFTLCLDWCALRDVAIIGELTGLTILSFKHSDIVELPREIRQLTKLKFLDLSHCLKLKVIPAKIISELTQLEELYMNNSFDLWDVQGINNQRNASLAELECLPYLTTLEICVLDAKILPKDLFFRKLERFRIFIGDVWSGTGDYGTSRTLKLKLNTSSIHLEHGLSILLEVTEDLYLAEVKGIKSVLYDLDSQGFTQLKHLDVQNDPEIQYIIDPNRRSPCNAFPILESLYLDNLMSLEKICCGKLTTGSFSKLRSLTVVKCDRLKNLFSFSMMRCLLQLQQMKVVDCANLEEIVACGSEDTDNDYEAVKLTQLCSLTLKRLPMFKSFCSKKKVSPISLRVQKQLTTDTGLKEIAPKGELGDPLPLFNEMFCFPNLENLELSSIACEKICDDQLSAISSNLMSLIVERCWNLKYLFTSSLVKNLLLLKRLEVFDCMSVEGIIVAEELVEEERNRKKLFPELDFLKLKNLPHITRFCDGYPVEFSSLRKLLIENCPALNMFVSKSPSADMIESREAKGMNSEKNHHTETQPLFNEKVAFPSLEEIELSYIDNLRRIWHNQLDAGSFCKLKIMRINGCKKLRTIFPSYLLERFQCLEKLSLSDCYALEEIYELQGLNFKEKHLLATSGLRELYIRSLPQLKSILSKDPQGNFTFLNLRLVDISYCSMKNLFPASVATGLLQLEKLVINHCFWMEEIFAKEKGGETAPSFVFLQLTSLELSDLPNFRRPGGEGQFSVPTQSPIPSMEKGELGISPSQCCMDELRLEPIENIPGDICENDPDDGLSSMFQGEMLQQLNNNNFPEFSDRNAGNPPSTSSSDKSNANAREEGMAMHLRHPTSTHVEEPGIEGIQIIGDAIPGERLIGCGYPVGGTSLCMFQWVRHLEDGSKQYIVGATEPHYVVTADDVDKLISVECIPLDDQGHQGKLMRLFANDQKKIQCDAGMQRKIDTYSSICEATFGVLLMMDSFDNWEPANLVLRQAGYQIKGKSEENVVIAEKFSKELLIKIPYGLSKQFILECFDGSSHTLSTYDSR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
39-1237 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KNWTEKLVSARERLQHSVDYAVRGGEEIENDVKRWIIGVDKAIEEADKLIKDDQEEATKRCFIGLCPNVKARYNLCKKMEKYSKVIAELQNKGRFDPVSYRVQLQQIVTSSVKNRGALHSRMSVLKEVMDALADPNVLMVGVCGMGGVGKTTLAKEVHQQVIEEKLFDIVVMATVSEKPDIRKIQGNIADVLGLKFDEETETGRAYRLRQRLMTEKKILVILDNIWAQLELEEVGIPCGVDHKGCKILLTSRSRDLLSCDMGVQKVFRLEVLQEEEALSLFEMMVGDVKGGEFQSAASEVTKKCAGLPVLIVTIARALKNKDLYVWKDAVKQLSRCDNEEIQEKVYSALELSYNHLIGAEVKSLFLLCGLLGKSDIAILDLLMYSTGLGLFKGIDTLGDARNRVHKLISDLKAACLLLDSDIKGRVKIHDVVRDVAISIASRMQHLFTVRNGALLKEWPNKDVCKSCTRISLPYNDIHGLPEVLECPELELFLLFTQDISLKVPDLCFELTKNLRVLNFTGMHFSSLPPSLGFLKNLFTLCLDWCALRDVAIIGELTGLTILSFKHSDIVELPREIRQLTKLKFLDLSHCLKLKVIPAKIISELTQLEELYMNNSFDLWDVQGINNQRNASLAELECLPYLTTLEICVLDAKILPKDLFFRKLERFRIFIGDVWSGTGDYGTSRTLKLKLNTSSIHLEHGLSILLEVTEDLYLAEVKGIKSVLYDLDSQGFTQLKHLDVQNDPEIQYIIDPNRRSPCNAFPILESLYLDNLMSLEKICCGKLTTGSFSKLRSLTVVKCDRLKNLFSFSMMRCLLQLQQMKVVDCANLEEIVACGSEDTDNDYEAVKLTQLCSLTLKRLPMFKSFCSKKKVSPISLRVQKQLTTDTGLKEIAPKGELGDPLPLFNEMFCFPNLENLELSSIACEKICDDQLSAISSNLMSLIVERCWNLKYLFTSSLVKNLLLLKRLEVFDCMSVEGIIVAEELVEEERNRKKLFPELDFLKLKNLPHITRFCDGYPVEFSSLRKLLIENCPALNMFVSKSPSADMIESREAKGMNSEKNHHTETQPLFNEKVAFPSLEEIELSYIDNLRRIWHNQLDAGSFCKLKIMRINGCKKLRTIFPSYLLERFQCLEKLSLSDCYALEEIYELQGLNFKEKHLLATSGLRELYIRSLPQLKSILSKDPQGNFTFLNLRLVDISYC

superfamily: SSF52540
139-379 SSF52540

RVQLQQIVTSSVKNRGALHSRMSVLKEVMDALADPNVLMVGVCGMGGVGKTTLAKEVHQQVIEEKLFDIVVMATVSEKPDIRKIQGNIADVLGLKFDEETETGRAYRLRQRLMTEKKILVILDNIWAQLELEEVGIPCGVDHKGCKILLTSRSRDLLSCDMGVQKVFRLEVLQEEEALSLFEMMVGDVKGGEFQSAASEVTKKCAGLPVLIVTIARALKNKDLYVWKDAVKQLSRCDNEEI

Gene3D: G3DSA:3.40.50.300
163-266 G3DSA:3.40.50.300

LKEVMDALADPNVLMVGVCGMGGVGKTTLAKEVHQQVIEEKLFDIVVMATVSEKPDIRKIQGNIADVLGLKFDEETETGRAYRLRQRLMTEKKILVILDNIWAQ

HMMPfam: PF00931
IPR002182
163-409 NB-ARC,NBS
NB-ARC

LKEVMDALADPNVLMVGVCGMGGVGKTTLAKEVHQQVIEEKLFDIVVMATVSEKPDIRKIQGNIADVLGLKFDEETETGRAYRLRQRLMTEKKILVILDNIWAQLELEEVGIPCGVDHKGCKILLTSRSRDLLSCDMGVQKVFRLEVLQEEEALSLFEMMVGDVKGGEFQSAASEVTKKCAGLPVLIVTIARALKNKDLYVWKDAVKQLSRCDNEEIQEKVYSALELSYNHLIGAEVKSLFLLCGLL

FPrintScan: PR00364
IPR000767
177-192 DISEASERSIST
Disease resistance protein

MVGVCGMGGVGKTTLA

FPrintScan: PR00364
IPR000767
250-264 DISEASERSIST
Disease resistance protein

LMTEKKILVILDNIW

FPrintScan: PR00364
IPR000767
342-356 DISEASERSIST
Disease resistance protein

CAGLPVLIVTIARAL

superfamily: SSF52058
465-922 SSF52058,LRR

KIHDVVRDVAISIASRMQHLFTVRNGALLKEWPNKDVCKSCTRISLPYNDIHGLPEVLECPELELFLLFTQDISLKVPDLCFELTKNLRVLNFTGMHFSSLPPSLGFLKNLFTLCLDWCALRDVAIIGELTGLTILSFKHSDIVELPREIRQLTKLKFLDLSHCLKLKVIPAKIISELTQLEELYMNNSFDLWDVQGINNQRNASLAELECLPYLTTLEICVLDAKILPKDLFFRKLERFRIFIGDVWSGTGDYGTSRTLKLKLNTSSIHLEHGLSILLEVTEDLYLAEVKGIKSVLYDLDSQGFTQLKHLDVQNDPEIQYIIDPNRRSPCNAFPILESLYLDNLMSLEKICCGKLTTGSFSKLRSLTVVKCDRLKNLFSFSMMRCLLQLQQMKVVDCANLEEIVACGSEDTDNDYEAVKLTQLCSLTLKRLPMFKSFCSKKKVSPISLRVQKQLTTD

Gene3D: G3DSA:3.80.10.10
499-654 G3DSA:3.80.10.10

KDVCKSCTRISLPYNDIHGLPEVLECPELELFLLFTQDISLKVPDLCFELTKNLRVLNFTGMHFSSLPPSLGFLKNLFTLCLDWCALRDVAIIGELTGLTILSFKHSDIVELPREIRQLTKLKFLDLSHCLKLKVIPAKIISELTQLEELYMNNSF

FPrintScan: PR00364
IPR000767
615-631 DISEASERSIST
Disease resistance protein

RQLTKLKFLDLSHCLKL

Gene3D: G3DSA:3.80.10.10
769-847 G3DSA:3.80.10.10

FTQLKHLDVQNDPEIQYIIDPNRRSPCNAFPILESLYLDNLMSLEKICCGKLTTGSFSKLRSLTVVKCDRLKNLFSFSM

superfamily: SSF52047
939-1269 SSF52047,LRR

PLFNEMFCFPNLENLELSSIACEKICDDQLSAISSNLMSLIVERCWNLKYLFTSSLVKNLLLLKRLEVFDCMSVEGIIVAEELVEEERNRKKLFPELDFLKLKNLPHITRFCDGYPVEFSSLRKLLIENCPALNMFVSKSPSADMIESREAKGMNSEKNHHTETQPLFNEKVAFPSLEEIELSYIDNLRRIWHNQLDAGSFCKLKIMRINGCKKLRTIFPSYLLERFQCLEKLSLSDCYALEEIYELQGLNFKEKHLLATSGLRELYIRSLPQLKSILSKDPQGNFTFLNLRLVDISYCSMKNLFPASVATGLLQLEKLVINHCFWMEEIF

Gene3D: G3DSA:3.80.10.10
946-1068 G3DSA:3.80.10.10

CFPNLENLELSSIACEKICDDQLSAISSNLMSLIVERCWNLKYLFTSSLVKNLLLLKRLEVFDCMSVEGIIVAEELVEEERNRKKLFPELDFLKLKNLPHITRFCDGYPVEFSSLRKLLIENC

Gene3D: G3DSA:3.80.10.10
1098-1268 G3DSA:3.80.10.10

HHTETQPLFNEKVAFPSLEEIELSYIDNLRRIWHNQLDAGSFCKLKIMRINGCKKLRTIFPSYLLERFQCLEKLSLSDCYALEEIYELQGLNFKEKHLLATSGLRELYIRSLPQLKSILSKDPQGNFTFLNLRLVDISYCSMKNLFPASVATGLLQLEKLVINHCFWMEEI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox