PRGDB00062234 (Disease resistance protein ADR1, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein ADR1, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255562650 (XM_002522285)
Gene Class CNL
Domain Type NBS, LRR, RPW8, Others
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein ADR1, putative, mRNA.

DNA Sequence

ATGGCAGCTGACTTAGTTGGCGGGGCTGTCCTTGGCGCAATACTTGGAGAGCTTCTAGAAGCAGTTCTGAGAGCTAAAAACAGAACCTTCATGTTCAAGTCAATACTAAAACGCATGGAATGCACGCTTGAAACCGTTACTCCAATCGTTAAGGAGATCGAAGAGCTGAACAAGGTATTGGATCGGAGAAATGAAGAAATGGGAATAATAATGAAAGAAATCAGGAAAGGCAAGAAGCTGGTTCTTGAATGCTCAGGAATGCAATGGTATTATGCATGTTGGAGAACACCTAAGTACGCAGGTAAGCTTATCAAGTTAGAAAAATCACTCAAGTTGTTCTTCCAAATTGTTATGCAAGCTCAACGAGCAAGAGATGGTAAAGAAGCGTTATTGGAGATGAAAGATCTTCGCATGGATTTAAAACGCTTAGGTTTGAATGCAAATAATAAAAGGGCGCATAGTGTGAATGGATATAGTCCTCCATTGGTGATTCCTGAGCCACCGACAAATCCTGTAGGACTAAAGGTTCCATTAGAGGAATTGAAAATGGAGCTGTTTAATGACGGGGCGTCCATTGTTGTATTGTCTGCTCCTCCAGGTTGCGGAAAGACCACATTGGCTAAACTACTTTGTCATGATGAACAAGTTAAAGAGAAATTTAGGGATAATATATTCTTTGTGATTGTGTCAAGAAAGCCAACCATGGAGGACATTGTACAGAAACTATTTCAGCACAAGGATTATGAGATGCCTTGGTTTCAAAATGACGAGCATATAGTTTACCACTTAGAACAATTTTTGAAGAGACTAGCACCAGATCCTATATTGTTAGTACTGGATGATATTTGGCATGATTCAGAATCTCTCCTTGACAAATTCAAGTTCCAAATCCCAAATTACAAGATTTTGGTGACATCAAGATCTGCATTTCCAAGATTTGGTTCTAATTCTACATATAAGCTGAAGCCACTGAATGATAAAGATGCCACGACTCTTTTCCGCAATTCAGCTTCCCTTCCTGAAAAGTTATGTGACATTGATGAAGATGTTGTCGACAAGATAGTGAAAGGGTGTAAGGGTATTCCACTAGCCCTTAAAGTGGTAGGTAGATCACTCTGTGGAGAACCTGAAGAAATTTGGAAAAGAAGAGAAATGGAACTGTCAAAAGGCAATACTATTTTTGAATACAGTGATATACTCAATTGTCTCCAGAGCAGTTTGGATGCCCTGGACAGTTCGATTATAATCAAGGAATGTTATATGGACCTGTGTGCATTTCCTGAAGACCAAAGAATTCCTGTCACTGCCCTCATTGATACGTGGGCAGAATTGTATGAACTAGATGAAGATGGTGTATATGCTGTCGCCAACCTTTATGAGCTCTCCACTCGGAATCTGATTGATCTCGTAGTCACAAGGAAAGATAGAAATGGCAGCTATAATCAGCACTTCGTTATCCAGCATGATCTTCTCAGAGAGCTAGCCATCCGCCAGAACAGCTTTGAATCCTTTGAGCAGACAAAAAGACTAGTTCTGGATACAAGTGCCGGTGATGCTTCCAACTGGTGGATGGGGCAAAAGCAGCCTAGCATAGTTTGCCGCCTCTTGTCTATCTCCACAGATGAGAAATTTGCTTCAATTTGGTGCAGCATACAAGCACCTGAAGCTGAGATTACCTGCGTTCTTGGAGAAAATGAAGAAATTAAAAGTTCTGGTCCTCACAAACTACAGTTTCTTCCCTACTTCAATAGGAAATTTCCCAGTTCTTGGTGCTGTATCCAATTTGAAGAGGATCAGATTGGAGAAGATTTCAATTCCTTCCTATGGCTTCACCTCTATAGAGTTCAAGAATCTACAGAAGATAACATTGGTGAAGCTTTTAGTAGTACATCTGCCATCAAGGTTTCAGAAGCATTGCCAAACTTGGTGGAATTAAACATCGACTACTGCAACGATTTCACAGAGTTGCCCGTTGGCCTGTGTCAACTTATCCAGCTAAAGAAATTCAGTGTCACCAATTGTCACAAGTTGGCTACATTGCCTAAAGAAATTGGCAAGTTGATTAATTTGGAGGTTGTAAGACTTAGTTCCTGTATCGAGCTGTTAGGGTTACCAAACACGATAGAAAGCCTCCAGAAGCTGAGCACTCTTGATATATCAGAGTGCTCAGAGATCAGGAAATTGCCAGGCCAGATTGGCGATCTGCATAATCTAAGAAAACTCCATATGATGGGTTGCTCAAACGATATTGAGTTGCCGCCATCATTGTTGAATCTTGAGCATCTTAAGGAAGTGATATGCGACGAAGAAATAGCCAGCTTATGGGAACCATTTGCAGAGCATCTCAAGAAGTTAAAAATTAAGGTGCATAAAGAAGATATCAACTTAAACTGGCTCTGCAATTGA


Protein sequences

Name Description Sequence
Disease resistance protein ADR1, putative Disease resistance protein ADR1, putative [Ricinus communis].

MAADLVGGAVLGAILGELLEAVLRAKNRTFMFKSILKRMECTLETVTPIVKEIEELNKVLDRRNEEMGIIMKEIRKGKKLVLECSGMQWYYACWRTPKYAGKLIKLEKSLKLFFQIVMQAQRARDGKEALLEMKDLRMDLKRLGLNANNKRAHSVNGYSPPLVIPEPPTNPVGLKVPLEELKMELFNDGASIVVLSAPPGCGKTTLAKLLCHDEQVKEKFRDNIFFVIVSRKPTMEDIVQKLFQHKDYEMPWFQNDEHIVYHLEQFLKRLAPDPILLVLDDIWHDSESLLDKFKFQIPNYKILVTSRSAFPRFGSNSTYKLKPLNDKDATTLFRNSASLPEKLCDIDEDVVDKIVKGCKGIPLALKVVGRSLCGEPEEIWKRREMELSKGNTIFEYSDILNCLQSSLDALDSSIIIKECYMDLCAFPEDQRIPVTALIDTWAELYELDEDGVYAVANLYELSTRNLIDLVVTRKDRNGSYNQHFVIQHDLLRELAIRQNSFESFEQTKRLVLDTSAGDASNWWMGQKQPSIVCRLLSISTDEKFASIWCSIQAPEAEITCVLGENEEIKSSGPHKLQFLPYFNRKFPSSWCCIQFEEDQIGEDFNSFLWLHLYRVQESTEDNIGEAFSSTSAIKVSEALPNLVELNIDYCNDFTELPVGLCQLIQLKKFSVTNCHKLATLPKEIGKLINLEVVRLSSCIELLGLPNTIESLQKLSTLDISECSEIRKLPGQIGDLHNLRKLHMMGCSNDIELPPSLLNLEHLKEVICDEEIASLWEPFAEHLKKLKIKVHKEDINLNWLCN

Domains

Domain Start-End Description Sequence

ProfileScan: PS51153
IPR008808
1-152 RPW8
Powdery mildew resistance protein, RPW8 domain

MAADLVGGAVLGAILGELLEAVLRAKNRTFMFKSILKRMECTLETVTPIVKEIEELNKVLDRRNEEMGIIMKEIRKGKKLVLECSGMQWYYACWRTPKYAGKLIKLEKSLKLFFQIVMQAQRARDGKEALLEMKDLRMDLKRLGLNANNKRA

HMMPfam: PF05659
IPR008808
3-142 RPW8
Powdery mildew resistance protein, RPW8 domain

ADLVGGAVLGAILGELLEAVLRAKNRTFMFKSILKRMECTLETVTPIVKEIEELNKVLDRRNEEMGIIMKEIRKGKKLVLECSGMQWYYACWRTPKYAGKLIKLEKSLKLFFQIVMQAQRARDGKEALLEMKDLRMDLKR

superfamily: SSF52540
153-387 SSF52540

HSVNGYSPPLVIPEPPTNPVGLKVPLEELKMELFNDGASIVVLSAPPGCGKTTLAKLLCHDEQVKEKFRDNIFFVIVSRKPTMEDIVQKLFQHKDYEMPWFQNDEHIVYHLEQFLKRLAPDPILLVLDDIWHDSESLLDKFKFQIPNYKILVTSRSAFPRFGSNSTYKLKPLNDKDATTLFRNSASLPEKLCDIDEDVVDKIVKGCKGIPLALKVVGRSLCGEPEEIWKRREMEL

HMMPanther: PTHR23155:SF239
172-762 PTHR23155:SF239,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

VGLKVPLEELKMELFNDGASIVVLSAPPGCGKTTLAKLLCHDEQVKEKFRDNIFFVIVSRKPTMEDIVQKLFQHKDYEMPWFQNDEHIVYHLEQFLKRLAPDPILLVLDDIWHDSESLLDKFKFQIPNYKILVTSRSAFPRFGSNSTYKLKPLNDKDATTLFRNSASLPEKLCDIDEDVVDKIVKGCKGIPLALKVVGRSLCGEPEEIWKRREMELSKGNTIFEYSDILNCLQSSLDALDSSIIIKECYMDLCAFPEDQRIPVTALIDTWAELYELDEDGVYAVANLYELSTRNLIDLVVTRKDRNGSYNQHFVIQHDLLRELAIRQNSFESFEQTKRLVLDTSAGDASNWWMGQKQPSIVCRLLSISTDEKFASIWCSIQAPEAEITCVLGENEEIKSSGPHKLQFLPYFNRKFPSSWCCIQFEEDQIGEDFNSFLWLHLYRVQESTEDNIGEAFSSTSAIKVSEALPNLVELNIDYCNDFTELPVGLCQLIQLKKFSVTNCHKLATLPKEIGKLINLEVVRLSSCIELLGLPNTIESLQKLSTLDISECSEIRKLPGQIGDLHNLRKLHMMGCSNDIELPPSLLNLEHL

HMMPanther: PTHR23155
172-762 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VGLKVPLEELKMELFNDGASIVVLSAPPGCGKTTLAKLLCHDEQVKEKFRDNIFFVIVSRKPTMEDIVQKLFQHKDYEMPWFQNDEHIVYHLEQFLKRLAPDPILLVLDDIWHDSESLLDKFKFQIPNYKILVTSRSAFPRFGSNSTYKLKPLNDKDATTLFRNSASLPEKLCDIDEDVVDKIVKGCKGIPLALKVVGRSLCGEPEEIWKRREMELSKGNTIFEYSDILNCLQSSLDALDSSIIIKECYMDLCAFPEDQRIPVTALIDTWAELYELDEDGVYAVANLYELSTRNLIDLVVTRKDRNGSYNQHFVIQHDLLRELAIRQNSFESFEQTKRLVLDTSAGDASNWWMGQKQPSIVCRLLSISTDEKFASIWCSIQAPEAEITCVLGENEEIKSSGPHKLQFLPYFNRKFPSSWCCIQFEEDQIGEDFNSFLWLHLYRVQESTEDNIGEAFSSTSAIKVSEALPNLVELNIDYCNDFTELPVGLCQLIQLKKFSVTNCHKLATLPKEIGKLINLEVVRLSSCIELLGLPNTIESLQKLSTLDISECSEIRKLPGQIGDLHNLRKLHMMGCSNDIELPPSLLNLEHL

HMMPfam: PF00931
IPR002182
178-443 NB-ARC,NBS
NB-ARC

LEELKMELFNDGASIVVLSAPPGCGKTTLAKLLCHDEQVKEKFRDNIFFVIVSRKPTMEDIVQKLFQHKDYEMPWFQNDEHIVYHLEQFLKRLAPDPILLVLDDIWHDSESLLDKFKFQIPNYKILVTSRSAFPRFGSNSTYKLKPLNDKDATTLFRNSASLPEKLCDIDEDVVDKIVKGCKGIPLALKVVGRSLCGEPEEIWKRREMELSKGNTIFEYSDILNCLQSSLDALDSSIIIKECYMDLCAFPEDQRIPVTALIDTWAE

Gene3D: G3DSA:3.40.50.300
187-294 G3DSA:3.40.50.300

NDGASIVVLSAPPGCGKTTLAKLLCHDEQVKEKFRDNIFFVIVSRKPTMEDIVQKLFQHKDYEMPWFQNDEHIVYHLEQFLKRLAPDPILLVLDDIWHDSESLLDKFK

HMMSmart: SM00382
IPR003593
189-337 AAA,NBS
ATPase, AAA+ type, core

GASIVVLSAPPGCGKTTLAKLLCHDEQVKEKFRDNIFFVIVSRKPTMEDIVQKLFQHKDYEMPWFQNDEHIVYHLEQFLKRLAPDPILLVLDDIWHDSESLLDKFKFQIPNYKILVTSRSAFPRFGSNSTYKLKPLNDKDATTLFRNSA

FPrintScan: PR00364
IPR000767
192-207 DISEASERSIST
Disease resistance protein

IVVLSAPPGCGKTTLA

FPrintScan: PR00364
IPR000767
269-283 DISEASERSIST
Disease resistance protein

RLAPDPILLVLDDIW

FPrintScan: PR00364
IPR000767
358-372 DISEASERSIST
Disease resistance protein

CKGIPLALKVVGRSL

Gene3D: G3DSA:3.80.10.10
464-501 G3DSA:3.80.10.10

RNLIDLVVTRKDRNGSYNQHFVIQHDLLRELAIRQNSF

superfamily: SSF52058
549-768 SSF52058,LRR

CSIQAPEAEITCVLGENEEIKSSGPHKLQFLPYFNRKFPSSWCCIQFEEDQIGEDFNSFLWLHLYRVQESTEDNIGEAFSSTSAIKVSEALPNLVELNIDYCNDFTELPVGLCQLIQLKKFSVTNCHKLATLPKEIGKLINLEVVRLSSCIELLGLPNTIESLQKLSTLDISECSEIRKLPGQIGDLHNLRKLHMMGCSNDIELPPSLLNLEHLKEVICD

Gene3D: G3DSA:3.80.10.10
628-768 G3DSA:3.80.10.10

SSTSAIKVSEALPNLVELNIDYCNDFTELPVGLCQLIQLKKFSVTNCHKLATLPKEIGKLINLEVVRLSSCIELLGLPNTIESLQKLSTLDISECSEIRKLPGQIGDLHNLRKLHMMGCSNDIELPPSLLNLEHLKEVICD

FPrintScan: PR00364
IPR000767
709-725 DISEASERSIST
Disease resistance protein

ESLQKLSTLDISECSEI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox