PRGDB00062235 (Disease resistance protein RPM1, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RPM1, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255561591 (XM_002521760)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RPM1, putative, mRNA.

DNA Sequence

ATGGCTGAAGGTTCAGTAGTATTTCTTCTTACTAAGCTAACAGAATTTCTCCAAAAAGAGGGGAGCCTATTGTCAGAAGTTCGAGAAGAAGTTGAGTACATCAATGATGAACTTGAGTTCATGAAGGCCTTTTTAAGAGTTGCAGAGGCAATGGAGGATAGTGACCTTCAACTCAAAGTGTTCGCAAAGAAAGTGAGATATGTTGTCTATGACCTCGAAGATGCTCTTGATGATTTCAAGTTGCACCTTCCTTCTGATCATGGATATGGGTTCCGTGCTTCTCTTCAGAAGATGTCTCATTTGATTAAGGGTTTAAAAGCTCGACATCAAATTGCTTTAAAAATGCAACGCATCAAAATCAGAGTGATAAATATCTCAGAAACACATCGAAGATATTTGATAAAAAATAATATCATGCAACAGGGCTCGAGTACCAGTGCTGAAAGACAGCCATCCAGAAGAAGGGATGCCCTTCAACTTGAAGAAGCTAATCCAGTGGGTATTGAACGTCCCAAGATGAAGCTTATTGAGTGGCTTGTCGAAGACAAATCTGAGCGTGAAGTGGTTTCAGTTGTTGGAATGGGTGGTTTGGGTAAGACTACCTTGGTGACAAAAGTGTATTATGATAAAGAAGTGAAGAAACGGTTTGAGTTCCGTGCTTGGATCACTCTTTCTCAATCTTTCACAATAGAAGACTTGTTGAAAGATATAATTCTACAACTCTCCCATGTTCTTCCATTATCAGACCCTCAAGGAGTGGACAACATGGACAATGCTAAGCTCAGAACAGTAATTGAAGAATTTCTTCAGGAACGGAGATACCTTATAGTCCTGGATAATGTCTCGGATACTAGAGCATGGTATGATTTTGAGCTTGTATTGCCAAACAATAGTTGTGGCAGCCGAATCTTGCTTACAACACGAAATCATGATGTTGCCTTTGCCTCATCTGCTGATAAAGCCTACAACCTGAGTCCATTATCTCAAGAAGAGTCTTGGACTTTGTTTTGCAGGAAAATATTTCAAAACAACCCCTGCCCTCCACTATTGAACGGAATTTTGCAAAAAATCCTGGTCAGATGTCAGGGATTGCCACTTGCAATTGTAGCAATTGGTGGAGTTCTTGCAATGAAGGATAGAAGTAGAATAGATGAATGGGAATTGGTGCATCAAGGTCTTGGCGCTGCTCTAGAAGATCATGACAGATTGAAAAGTATACTCTCCCTAAGTTACAATGATTTGCCTTACTATCTGAAATACTGTTTGATGTATTTTAGCATCTTTCCTGTGGGTGACTTAATTGAGCGTGCGAAACTTGTTCGATTATGGATAGCAGAAGGGTTTGTTAAAGAAAAGGAAGGAATGACATTAGAGGAAGTTGCAGAAGGCTACCTGAATGAGCTTGTAAAAAGAAGTTTGGTCCAAGTGGTAGAGACAACTAGTGATGGACGAGTCAAAACATGCCGAGTCCATGACATTCTCCTAGAAATGATAATTTGGAAGTCAAGAGACCAAGATTTTGCGGCCATAGCTAATGAACAGAACACTAGCATGATGTGGCCTGAAAAGATCCGCCGCTTATCAATACATAATGTCATGCCAAGCATACAAGAAATACTTATTGCCTCTCGACCACGTTCACTGCTCATGTTTTGGTGGTTTGATTCTTTACCTAAATCCTTCGTATTGATTTTATCTTCTCATCGTTTAAGATTGCTCAATGTTTTAGATCTAGGAGGCACACCTTTAAAGAAATTTCCAAATGAAGTTGTCAGTCTCTACCTTCTAAAATATCTGAGTTTAAGGAATACCAAGGTGACTTCGATTCCAAGCTCTATAGGTAAGCTTCAGAACCTAGAAACCTTGGATTTGAAGCAGACCCATGTCACTGAATTGCCTGCCGAGATTCTGAAGCTCCAAAAGCTTTGCCACCTACTAGTATATCGCTATGAAATTGAGTCTGATGATCAGATTCACACCAAATATGGCTGCAAGGCACCAGCTCAAATAGGAAGTTTGCAGTCTTTACAAAAGCTTTGCTTCCTGGAAGCAAATCAAGGCAATACTCTTTTGGCAGAACTGGGAAAACTAAATCAGCTGAGGAGGTTAGGCATTGTAAAGATAAGGACAGAAGATGGGAGGACGCTGTGCGCTTCCATTGAAAGGCTGAGAAACCTTCGTGCATTGTCTATTTCTGTAGAAGAGAGTGAGGTCATTGACATAAATTACTTATCTTCTCCTCCTAGATTTCTTCAACGGTTGTACTTGACAGGACGTTTGGAGAATTTACCAGAATGGATATCTTCACTTGATAGTTTGGTGAAGGTTGTTCTGAAATGGAGTGGGTTAAGTGATGATCCGTTGCTATTGCTTCAGCATTTACCCAATCTGGTCCATCTTGAATTTGTGCAGGTTTATGATGGAGAGATTTTGTGTTTTCAAGCCAGGGGGTTTCAAAGGCTTAAGGTTTTGGGGCTAAACAAGTTACATAGACTCAATACAATAACTATTGAGCAGGGAGCAATGCCTAATCTTGAAAAGCTGATTGTTCAGAGCTGCAGGTCACTGCAGAGGGTGCCATTAGGCATTGAATACCTGAATGAGCTTAAAGTTCTGGAGTTCTACAACATGCCTTTAGAATTAATCATGGCATTGCATCCCAGTGGAGGAGAAAATGGAGACTACTGGAAGGTTGAGCGCGTCCCGGAGGTTTACTTCACCTACTGGTATGATGGTAATTGGGATATCATTTCTATGGAGAGTTTCAAAGACAAAAGCTCTGCTCAGTCTGGTTCAAGCATTATGCAGCGTCCTCGGCATATCTGGAAATAG


Protein sequences

Name Description Sequence
Disease resistance protein RPM1, putative Disease resistance protein RPM1, putative [Ricinus communis].

MAEGSVVFLLTKLTEFLQKEGSLLSEVREEVEYINDELEFMKAFLRVAEAMEDSDLQLKVFAKKVRYVVYDLEDALDDFKLHLPSDHGYGFRASLQKMSHLIKGLKARHQIALKMQRIKIRVINISETHRRYLIKNNIMQQGSSTSAERQPSRRRDALQLEEANPVGIERPKMKLIEWLVEDKSEREVVSVVGMGGLGKTTLVTKVYYDKEVKKRFEFRAWITLSQSFTIEDLLKDIILQLSHVLPLSDPQGVDNMDNAKLRTVIEEFLQERRYLIVLDNVSDTRAWYDFELVLPNNSCGSRILLTTRNHDVAFASSADKAYNLSPLSQEESWTLFCRKIFQNNPCPPLLNGILQKILVRCQGLPLAIVAIGGVLAMKDRSRIDEWELVHQGLGAALEDHDRLKSILSLSYNDLPYYLKYCLMYFSIFPVGDLIERAKLVRLWIAEGFVKEKEGMTLEEVAEGYLNELVKRSLVQVVETTSDGRVKTCRVHDILLEMIIWKSRDQDFAAIANEQNTSMMWPEKIRRLSIHNVMPSIQEILIASRPRSLLMFWWFDSLPKSFVLILSSHRLRLLNVLDLGGTPLKKFPNEVVSLYLLKYLSLRNTKVTSIPSSIGKLQNLETLDLKQTHVTELPAEILKLQKLCHLLVYRYEIESDDQIHTKYGCKAPAQIGSLQSLQKLCFLEANQGNTLLAELGKLNQLRRLGIVKIRTEDGRTLCASIERLRNLRALSISVEESEVIDINYLSSPPRFLQRLYLTGRLENLPEWISSLDSLVKVVLKWSGLSDDPLLLLQHLPNLVHLEFVQVYDGEILCFQARGFQRLKVLGLNKLHRLNTITIEQGAMPNLEKLIVQSCRSLQRVPLGIEYLNELKVLEFYNMPLELIMALHPSGGENGDYWKVERVPEVYFTYWYDGNWDIISMESFKDKSSAQSGSSIMQRPRHIWK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
9-883 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LLTKLTEFLQKEGSLLSEVREEVEYINDELEFMKAFLRVAEAMEDSDLQLKVFAKKVRYVVYDLEDALDDFKLHLPSDHGYGFRASLQKMSHLIKGLKARHQIALKMQRIKIRVINISETHRRYLIKNNIMQQGSSTSAERQPSRRRDALQLEEANPVGIERPKMKLIEWLVEDKSEREVVSVVGMGGLGKTTLVTKVYYDKEVKKRFEFRAWITLSQSFTIEDLLKDIILQLSHVLPLSDPQGVDNMDNAKLRTVIEEFLQERRYLIVLDNVSDTRAWYDFELVLPNNSCGSRILLTTRNHDVAFASSADKAYNLSPLSQEESWTLFCRKIFQNNPCPPLLNGILQKILVRCQGLPLAIVAIGGVLAMKDRSRIDEWELVHQGLGAALEDHDRLKSILSLSYNDLPYYLKYCLMYFSIFPVGDLIERAKLVRLWIAEGFVKEKEGMTLEEVAEGYLNELVKRSLVQVVETTSDGRVKTCRVHDILLEMIIWKSRDQDFAAIANEQNTSMMWPEKIRRLSIHNVMPSIQEILIASRPRSLLMFWWFDSLPKSFVLILSSHRLRLLNVLDLGGTPLKKFPNEVVSLYLLKYLSLRNTKVTSIPSSIGKLQNLETLDLKQTHVTELPAEILKLQKLCHLLVYRYEIESDDQIHTKYGCKAPAQIGSLQSLQKLCFLEANQGNTLLAELGKLNQLRRLGIVKIRTEDGRTLCASIERLRNLRALSISVEESEVIDINYLSSPPRFLQRLYLTGRLENLPEWISSLDSLVKVVLKWSGLSDDPLLLLQHLPNLVHLEFVQVYDGEILCFQARGFQRLKVLGLNKLHRLNTITIEQGAMPNLEKLIVQSCRSLQRVPLGIEYLNELKVLEFYNMPLELIM

superfamily: SSF52540
148-399 SSF52540

ERQPSRRRDALQLEEANPVGIERPKMKLIEWLVEDKSEREVVSVVGMGGLGKTTLVTKVYYDKEVKKRFEFRAWITLSQSFTIEDLLKDIILQLSHVLPLSDPQGVDNMDNAKLRTVIEEFLQERRYLIVLDNVSDTRAWYDFELVLPNNSCGSRILLTTRNHDVAFASSADKAYNLSPLSQEESWTLFCRKIFQNNPCPPLLNGILQKILVRCQGLPLAIVAIGGVLAMKDRSRIDEWELVHQGLGAALED

HMMPfam: PF00931
IPR002182
170-452 NB-ARC,NBS
NB-ARC

RPKMKLIEWLVEDKSEREVVSVVGMGGLGKTTLVTKVYYDKEVKKRFEFRAWITLSQSFTIEDLLKDIILQLSHVLPLSDPQGVDNMDNAKLRTVIEEFLQERRYLIVLDNVSDTRAWYDFELVLPNNSCGSRILLTTRNHDVAFASSADKAYNLSPLSQEESWTLFCRKIFQNNPCPPLLNGILQKILVRCQGLPLAIVAIGGVLAMKDRSRIDEWELVHQGLGAALEDHDRLKSILSLSYNDLPYYLKYCLMYFSIFPVGDLIERAKLVRLWIAEGFVKEK

Gene3D: G3DSA:3.40.50.300
177-311 G3DSA:3.40.50.300

EWLVEDKSEREVVSVVGMGGLGKTTLVTKVYYDKEVKKRFEFRAWITLSQSFTIEDLLKDIILQLSHVLPLSDPQGVDNMDNAKLRTVIEEFLQERRYLIVLDNVSDTRAWYDFELVLPNNSCGSRILLTTRNHD

FPrintScan: PR00364
IPR000767
188-203 DISEASERSIST
Disease resistance protein

VVSVVGMGGLGKTTLV

FPrintScan: PR00364
IPR000767
268-282 DISEASERSIST
Disease resistance protein

FLQERRYLIVLDNVS

FPrintScan: PR00364
IPR000767
361-375 DISEASERSIST
Disease resistance protein

CQGLPLAIVAIGGVL

superfamily: SSF52058
489-880 SSF52058,LRR

RVHDILLEMIIWKSRDQDFAAIANEQNTSMMWPEKIRRLSIHNVMPSIQEILIASRPRSLLMFWWFDSLPKSFVLILSSHRLRLLNVLDLGGTPLKKFPNEVVSLYLLKYLSLRNTKVTSIPSSIGKLQNLETLDLKQTHVTELPAEILKLQKLCHLLVYRYEIESDDQIHTKYGCKAPAQIGSLQSLQKLCFLEANQGNTLLAELGKLNQLRRLGIVKIRTEDGRTLCASIERLRNLRALSISVEESEVIDINYLSSPPRFLQRLYLTGRLENLPEWISSLDSLVKVVLKWSGLSDDPLLLLQHLPNLVHLEFVQVYDGEILCFQARGFQRLKVLGLNKLHRLNTITIEQGAMPNLEKLIVQSCRSLQRVPLGIEYLNELKVLEFYNMPLE

Gene3D: G3DSA:3.80.10.10
554-653 G3DSA:3.80.10.10

FDSLPKSFVLILSSHRLRLLNVLDLGGTPLKKFPNEVVSLYLLKYLSLRNTKVTSIPSSIGKLQNLETLDLKQTHVTELPAEILKLQKLCHLLVYRYEIE

HMMPfam: PF12799
596-634 LRR_4,Leucine Rich repeats (2 copies)

LKYLSLRNTKVTSIPSSIGKLQNLETLDLKQTHVTELPA

FPrintScan: PR00364
IPR000767
614-630 DISEASERSIST
Disease resistance protein

GKLQNLETLDLKQTHVT

Gene3D: G3DSA:3.80.10.10
664-877 G3DSA:3.80.10.10

CKAPAQIGSLQSLQKLCFLEANQGNTLLAELGKLNQLRRLGIVKIRTEDGRTLCASIERLRNLRALSISVEESEVIDINYLSSPPRFLQRLYLTGRLENLPEWISSLDSLVKVVLKWSGLSDDPLLLLQHLPNLVHLEFVQVYDGEILCFQARGFQRLKVLGLNKLHRLNTITIEQGAMPNLEKLIVQSCRSLQRVPLGIEYLNELKVLEFYNM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox