PRGDB00062237 (Disease resistance protein RFL1, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RFL1, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255561557 (XM_002521743)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RFL1, putative, mRNA.

DNA Sequence

ATGGAGTATCTTATAGCAATTGTGAGTTCTGGTGCCAGTGAAATTGGAAAATCATTGGCGATCAGTATCAAAAGACATATTGGCTACTTGGTTTACTACAATCGTAACATTACGAACCTGCAAGATGAAAGAAAGAAGCTGGATGATAAAATGGTTGAAGCTGATCAATTTGTGCAAGATGCTAACCGGAAGTTTAAAGTTCCTATTCCTAGTGTACCCCGTTGGAAAGAGGAAGCAGACAAGCTCAACCAAAAGGTCGGTGAATTTTTTGAAAAGGAAACTCCTGGAGCAAGCAACAGGTGTTTGAACGGGCGTTGTCAATATCCGTGGTCACGTTATTCATCAAGCAGGAAAGCTTCAAAGATGACTGAGGATATTCGTGAGAAGATTCGAGACGCTCCAGATTTTGGTATTGTAGCCTATGATGCTCCTCAACCAAATCTGGGATCTACGTTCAACCTTGAAGGTGTCAAGGACTTTGAGTCTAGGCTATCAGTTATGAATGACGTCTGGGAGGCTTTGAAGAATGATGAGCTGAGCATGATTGGTATTTGTGGAATGGCTGGTGTAGGGAAAACCACACTGGTTAAAAAACTAGTGAAAAGAATAGAAACTGAAAATCTGTTTGGTGTAGTTGCAATGACTGTGGTCTCTCAAAATCCAAACTCGACTATCCAAGATGTGATTATAGAGCGGTTCAGTTTGCAATTTGAGGAGAAGACTTTGGTGGGAAGAGCAAGTAAGCTGCATGAGTGGATTATGAAGTGTGACAAGAGAGTGCTCTTGATCTTGGATGATGTCTGGGAGAAGGTGGATTTTGAAGCAATTGGACTTCCTTTAAATGGTGACAGAAAGGGGTACAAAATTGTGTTAACTTCACGAAGGGATGATCTATGCACTAAAATAGGAAGTCAAAAGAACTTCCTTATTGATATTTTAAAAGAAGAAGAAGCTCGAGGTCTTTTCAAAGTGACGGTAGGCAATTCCATTGAAGGAAATTTAGTCGGCATAGCATGTGAAATTGCGGATCGATGTGGAGGCTTGCCTATTGCCATTGTAGCTCTTGCTAAGGCTTTGAAATCCAAACCAAAGCATAGATGGGATGATGCACTCCTACAGCTAAAGACGTCTAACATGAAAGGCATCTTGGAAATGGGGGAGGTGGATTCCAGACTTAAACTGAGTATTGATCTTTTGGAAAGTGACCAAGCCAAGGCACTACTTTTCCTTTGTTGCTTGTTCCCTGAAGATTATAGTGTTCCTGTAGAACATTTGGTTGGTCATGGGATAGGCCTGGGGTGGTTTCAAAACGTGCAGTTTTTGTATCAGGCAAGAGACAGAGTTCGTACGCTTATTGATGAACTCAAGGAATCGTTTTTGTTGCTTGAGGGCGATTCAGATGAATATGAATCCGTCAAGATGCATGATCTGATACGTGATGTCGCCATAGTCATTGCCAAAGATAACTCTGGATATCTAGTGTGTTGTAATTCTAATATGAAAAGCTGGCCTGCGGAGATGGATAGGTACAAAAATTTCACTGCGATTTCACTTGTTCGAATAAAAATCGACGAGCACCTTGTTGATTTGGAATGTCCAAAGCTACAACTTTTACAGCTCTGGTGCGAGAATGATTCACAACCTTTACCTAATAATTCTTTTGGAGGTATGAAAGAACTCAAAGTTTTATCTTTGGAGATACCATTACTTCCACAGCCACTTGATGTCTTGAAGAAACTTCGAACCTTGCATCTTTATCGTTTGAAGTATGGAGAGATATCTGCAATTGGAGCACTAATTACTTTAGAAATTCTTCGAATTGAAACTGATTGGGACTCTTACTTAAAAGAGTTGCCAATAGAAATAGGAAGACTAAGAAATTTGAGGGTACTGAATTTGAGCTCAATGTCATCCCTCAGATACATCCCATTAGGTGTATTATCAAAAATGTCAAATCTAGAAGAGTTGTATGTAAGTACGAAATTCATGGCATGGGGATTGATAGAAGATGGAAAGGAAAATGCAAGCCTCAAGGAGCTGGAGTCTCATCCAATAACTGCATTGGAGATTTATGTATTCAATTTCTTGGTTTTTCCTAAAGAGTGGGTCATTAGCAACCTAAGTAGATTTAAAGTTGTTATAGGCACACATTTCAAATACAATTCATATGGAAAAGATTCAATGAATGAGTTGTACATCGAAGGTGATGGGAATGATGTTTTAGCAAGTGGGTTCAGTGCTTTGCTGAGGAACACCGAAGTTTTAGGTCTAAAGGTGAACAATTTGAAGAATTGTCTCTTGGAGTTAGAAGATGAAGGTTCAGAAGAAACTTCACAATTGCGGAATAAGGATCTGTGCTTTTATAAACTAAAAGATGTAAGAATATTTGAATCTCATGAGATGAAATATGTTTTTCCACTGTCCATGGCTAGAGGATTGAAGCAACTCCAAAGCATAAACATAAAGTATTGCGACGAGATTGAGGGAATTTTCTATGGAAAGGAAGAGGATGATGAGAAGATAATTTCCAAAGATGACGATTCTGATATTGAGTTTCCTCAACTAAAAATGTTGTATCTGTATAATCTTCCAAAGCTGATTGGTTTTTGGATACACAAGGATAAGGTTTTATCAGATATCTCTAAACAATCAAGTGCATCTCACATAAATGAGAAGACGAGGATCGGACCATCACTATTTTCATCGCATCGGCTACAGTTGCCAAATTTGCAAGAGCTCAATTTGCGGGATTGTGGTTTGCTGAAGGTGGTCTTCTCAACTTCCATTGCAGGACAACTGATGCAACTCAAAAAGTTAACTTTACGGAGATGTAAAAGAATTGAATATGTAGTTGCAGGAGGAGAAGAAGACCATAAGAGAAAAACCAAAATAGTGTTCCCTATGCTAATGTCTATTTATTTCTCAGAACTACCAGAGCTAGTGGCCTTCTATCCTGACGGTCATACTTCCTTTGGCTCTCTAAATGAATTAAAGGTAAGAAATTGTCCCAAAATGAAGACATTTCCTTCAATATATCCAAGTGTCGACTCAACTGTTCAATGGCAAAGCTCTAATCAGCAGCTTCAGTCAAGCCAAGAGCCCACAGAGGTTTCATTATTGAAGAACAAGTTCACTTCTAGCCATAATTACGACCACACGGGCACATGTTGTGCATTTTCATTCAAATCAATCGAAGCGCTTAGGAATCTCAATAAACTTGCATTGTTTAAGAATGATGAATTCGAGGTAATATTTTCATTTGAAGAATGGCGTTCTGATGGAGTAATGCTCAGTGTTTTGGAGAAACTGGAGTTGTCATTTTTACCAAAATTAGCGCACATATGGTTCAAAATTCCACCAGAAATCACAGCCTTTCAAAACCTAAAAGAGTTGGATGTATATGATTGTTCTTCTTTAAAATATATTTTCTCACCCTGTGCGATTAAACTTCTGGTAAGACTAGAAAAAGTAATAGTTGATGAGTGCCATGGGATAGAAGCAATTGTTGCAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAAGCCATAGAAACATTATTTTCCCTCAATTAAGGTTCTTGCAGCTTACAAGTTTAACAAAGCTCAAGAGTTTCTGCAGTGATAGATCTACAACAGTTGAATTTCCATTATTAGAAGATTTGAGATTGAAAAATGTGGGTGCAATGATGGAGGAAAAGGTACAATATCAGAACAAGGGTGAATTTGGTCATAGTTACAGCCACGCAGAGACATGTCCTCCATTTACAATCAGATCCATTAAAAGGATACGAAATCTTAAAAGACTTGAGGTGGGCAGTTGTCAATCGTTGGAAGTGATATATTTGTTTGAGGAAAACCATGCTGATGGAGTACTTTTTAATAATCTGGAAGAACTGAGATTGGATTTTTTACCAAATTTCAAGCATGTGTTGCTCAAGATACCACCAGAAATTTCAGCCTTTCAAAACCTGAAAAAAATAAATATAGAATATTGTGATCATTTGAAGTATCTTTTTTCACCTCCTGTGGCCAAACTTCTAGTAAAGCTAGAAGTAGTAAGAATTATAGAGTGCAAAATGGTGGAAGCAATGGTTGCAGAAGAGAAATTAGAAGCAGAAGCAAGAAGTGACAGAATTGTATTCCCTCGACTAAGGTTCCTGGAACTTCAATCTTTACACAAATTCAAGAGTTTTTGCATTGAGAATTCTGTCACAGTCGAATTGCCTCTGTTAGAAGACTTGAAACTTGTACATTGTCATCAAATAAGGACTTTCTCTTATGGATCAGTGATCACACCAAAACTAAAGACAATGAGAATAGATTCCCGCTACTATCAATTAGAGAAAGACCTTAATACAACTCTGCTAGAAATGTGTTCCAAAAGAGGAAAGGATGCAATGGACGCCAATATAGTGGATGTGGCAGGTCCTTTTAAGCATGAAGTAGATGTGAAGAGCAAATAG


Protein sequences

Name Description Sequence
Disease resistance protein RFL1, putative Disease resistance protein RFL1, putative [Ricinus communis].

MEYLIAIVSSGASEIGKSLAISIKRHIGYLVYYNRNITNLQDERKKLDDKMVEADQFVQDANRKFKVPIPSVPRWKEEADKLNQKVGEFFEKETPGASNRCLNGRCQYPWSRYSSSRKASKMTEDIREKIRDAPDFGIVAYDAPQPNLGSTFNLEGVKDFESRLSVMNDVWEALKNDELSMIGICGMAGVGKTTLVKKLVKRIETENLFGVVAMTVVSQNPNSTIQDVIIERFSLQFEEKTLVGRASKLHEWIMKCDKRVLLILDDVWEKVDFEAIGLPLNGDRKGYKIVLTSRRDDLCTKIGSQKNFLIDILKEEEARGLFKVTVGNSIEGNLVGIACEIADRCGGLPIAIVALAKALKSKPKHRWDDALLQLKTSNMKGILEMGEVDSRLKLSIDLLESDQAKALLFLCCLFPEDYSVPVEHLVGHGIGLGWFQNVQFLYQARDRVRTLIDELKESFLLLEGDSDEYESVKMHDLIRDVAIVIAKDNSGYLVCCNSNMKSWPAEMDRYKNFTAISLVRIKIDEHLVDLECPKLQLLQLWCENDSQPLPNNSFGGMKELKVLSLEIPLLPQPLDVLKKLRTLHLYRLKYGEISAIGALITLEILRIETDWDSYLKELPIEIGRLRNLRVLNLSSMSSLRYIPLGVLSKMSNLEELYVSTKFMAWGLIEDGKENASLKELESHPITALEIYVFNFLVFPKEWVISNLSRFKVVIGTHFKYNSYGKDSMNELYIEGDGNDVLASGFSALLRNTEVLGLKVNNLKNCLLELEDEGSEETSQLRNKDLCFYKLKDVRIFESHEMKYVFPLSMARGLKQLQSINIKYCDEIEGIFYGKEEDDEKIISKDDDSDIEFPQLKMLYLYNLPKLIGFWIHKDKVLSDISKQSSASHINEKTRIGPSLFSSHRLQLPNLQELNLRDCGLLKVVFSTSIAGQLMQLKKLTLRRCKRIEYVVAGGEEDHKRKTKIVFPMLMSIYFSELPELVAFYPDGHTSFGSLNELKVRNCPKMKTFPSIYPSVDSTVQWQSSNQQLQSSQEPTEVSLLKNKFTSSHNYDHTGTCCAFSFKSIEALRNLNKLALFKNDEFEVIFSFEEWRSDGVMLSVLEKLELSFLPKLAHIWFKIPPEITAFQNLKELDVYDCSSLKYIFSPCAIKLLVRLEKVIVDECHGIEAIVAEEEEEEEEEESHRNIIFPQLRFLQLTSLTKLKSFCSDRSTTVEFPLLEDLRLKNVGAMMEEKVQYQNKGEFGHSYSHAETCPPFTIRSIKRIRNLKRLEVGSCQSLEVIYLFEENHADGVLFNNLEELRLDFLPNFKHVLLKIPPEISAFQNLKKINIEYCDHLKYLFSPPVAKLLVKLEVVRIIECKMVEAMVAEEKLEAEARSDRIVFPRLRFLELQSLHKFKSFCIENSVTVELPLLEDLKLVHCHQIRTFSYGSVITPKLKTMRIDSRYYQLEKDLNTTLLEMCSKRGKDAMDANIVDVAGPFKHEVDVKSK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF20
7-1025 PTHR11017:SF20,SUBFAMILY NOT NAMED

IVSSGASEIGKSLAISIKRHIGYLVYYNRNITNLQDERKKLDDKMVEADQFVQDANRKFKVPIPSVPRWKEEADKLNQKVGEFFEKETPGASNRCLNGRCQYPWSRYSSSRKASKMTEDIREKIRDAPDFGIVAYDAPQPNLGSTFNLEGVKDFESRLSVMNDVWEALKNDELSMIGICGMAGVGKTTLVKKLVKRIETENLFGVVAMTVVSQNPNSTIQDVIIERFSLQFEEKTLVGRASKLHEWIMKCDKRVLLILDDVWEKVDFEAIGLPLNGDRKGYKIVLTSRRDDLCTKIGSQKNFLIDILKEEEARGLFKVTVGNSIEGNLVGIACEIADRCGGLPIAIVALAKALKSKPKHRWDDALLQLKTSNMKGILEMGEVDSRLKLSIDLLESDQAKALLFLCCLFPEDYSVPVEHLVGHGIGLGWFQNVQFLYQARDRVRTLIDELKESFLLLEGDSDEYESVKMHDLIRDVAIVIAKDNSGYLVCCNSNMKSWPAEMDRYKNFTAISLVRIKIDEHLVDLECPKLQLLQLWCENDSQPLPNNSFGGMKELKVLSLEIPLLPQPLDVLKKLRTLHLYRLKYGEISAIGALITLEILRIETDWDSYLKELPIEIGRLRNLRVLNLSSMSSLRYIPLGVLSKMSNLEELYVSTKFMAWGLIEDGKENASLKELESHPITALEIYVFNFLVFPKEWVISNLSRFKVVIGTHFKYNSYGKDSMNELYIEGDGNDVLASGFSALLRNTEVLGLKVNNLKNCLLELEDEGSEETSQLRNKDLCFYKLKDVRIFESHEMKYVFPLSMARGLKQLQSINIKYCDEIEGIFYGKEEDDEKIISKDDDSDIEFPQLKMLYLYNLPKLIGFWIHKDKVLSDISKQSSASHINEKTRIGPSLFSSHRLQLPNLQELNLRDCGLLKVVFSTSIAGQLMQLKKLTLRRCKRIEYVVAGGEEDHKRKTKIVFPMLMSIYFSELPELVAFYPDGHTSFGSLNELKVRNCPKMKTFPSIYPSVDSTVQWQSSN

HMMPanther: PTHR11017
7-1025 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IVSSGASEIGKSLAISIKRHIGYLVYYNRNITNLQDERKKLDDKMVEADQFVQDANRKFKVPIPSVPRWKEEADKLNQKVGEFFEKETPGASNRCLNGRCQYPWSRYSSSRKASKMTEDIREKIRDAPDFGIVAYDAPQPNLGSTFNLEGVKDFESRLSVMNDVWEALKNDELSMIGICGMAGVGKTTLVKKLVKRIETENLFGVVAMTVVSQNPNSTIQDVIIERFSLQFEEKTLVGRASKLHEWIMKCDKRVLLILDDVWEKVDFEAIGLPLNGDRKGYKIVLTSRRDDLCTKIGSQKNFLIDILKEEEARGLFKVTVGNSIEGNLVGIACEIADRCGGLPIAIVALAKALKSKPKHRWDDALLQLKTSNMKGILEMGEVDSRLKLSIDLLESDQAKALLFLCCLFPEDYSVPVEHLVGHGIGLGWFQNVQFLYQARDRVRTLIDELKESFLLLEGDSDEYESVKMHDLIRDVAIVIAKDNSGYLVCCNSNMKSWPAEMDRYKNFTAISLVRIKIDEHLVDLECPKLQLLQLWCENDSQPLPNNSFGGMKELKVLSLEIPLLPQPLDVLKKLRTLHLYRLKYGEISAIGALITLEILRIETDWDSYLKELPIEIGRLRNLRVLNLSSMSSLRYIPLGVLSKMSNLEELYVSTKFMAWGLIEDGKENASLKELESHPITALEIYVFNFLVFPKEWVISNLSRFKVVIGTHFKYNSYGKDSMNELYIEGDGNDVLASGFSALLRNTEVLGLKVNNLKNCLLELEDEGSEETSQLRNKDLCFYKLKDVRIFESHEMKYVFPLSMARGLKQLQSINIKYCDEIEGIFYGKEEDDEKIISKDDDSDIEFPQLKMLYLYNLPKLIGFWIHKDKVLSDISKQSSASHINEKTRIGPSLFSSHRLQLPNLQELNLRDCGLLKVVFSTSIAGQLMQLKKLTLRRCKRIEYVVAGGEEDHKRKTKIVFPMLMSIYFSELPELVAFYPDGHTSFGSLNELKVRNCPKMKTFPSIYPSVDSTVQWQSSN

superfamily: SSF52540
166-382 SSF52540

VMNDVWEALKNDELSMIGICGMAGVGKTTLVKKLVKRIETENLFGVVAMTVVSQNPNSTIQDVIIERFSLQFEEKTLVGRASKLHEWIMKCDKRVLLILDDVWEKVDFEAIGLPLNGDRKGYKIVLTSRRDDLCTKIGSQKNFLIDILKEEEARGLFKVTVGNSIEGNLVGIACEIADRCGGLPIAIVALAKALKSKPKHRWDDALLQLKTSNMKGI

HMMPfam: PF00931
IPR002182
167-426 NB-ARC,NBS
NB-ARC

MNDVWEALKNDELSMIGICGMAGVGKTTLVKKLVKRIETENLFGVVAMTVVSQNPNSTIQDVIIERFSLQFEEKTLVGRASKLHEWIMKCDKRVLLILDDVWEKVDFEAIGLPLNGDRKGYKIVLTSRRDDLCTKIGSQKNFLIDILKEEEARGLFKVTVGNSIEGNLVGIACEIADRCGGLPIAIVALAKALKSKPKHRWDDALLQLKTSNMKGILEMGEVDSRLKLSIDLLESDQAKALLFLCCLFPEDYSVPVEHLV

Gene3D: G3DSA:3.40.50.300
173-303 G3DSA:3.40.50.300

ALKNDELSMIGICGMAGVGKTTLVKKLVKRIETENLFGVVAMTVVSQNPNSTIQDVIIERFSLQFEEKTLVGRASKLHEWIMKCDKRVLLILDDVWEKVDFEAIGLPLNGDRKGYKIVLTSRRDDLCTKIG

HMMSmart: SM00382
IPR003593
178-314 AAA,NBS
ATPase, AAA+ type, core

ELSMIGICGMAGVGKTTLVKKLVKRIETENLFGVVAMTVVSQNPNSTIQDVIIERFSLQFEEKTLVGRASKLHEWIMKCDKRVLLILDDVWEKVDFEAIGLPLNGDRKGYKIVLTSRRDDLCTKIGSQKNFLIDILK

FPrintScan: PR00364
IPR000767
181-196 DISEASERSIST
Disease resistance protein

MIGICGMAGVGKTTLV

FPrintScan: PR00364
IPR000767
254-268 DISEASERSIST
Disease resistance protein

MKCDKRVLLILDDVW

FPrintScan: PR00364
IPR000767
345-359 DISEASERSIST
Disease resistance protein

CGGLPIAIVALAKAL

superfamily: SSF52058
473-1025 SSF52058,LRR

KMHDLIRDVAIVIAKDNSGYLVCCNSNMKSWPAEMDRYKNFTAISLVRIKIDEHLVDLECPKLQLLQLWCENDSQPLPNNSFGGMKELKVLSLEIPLLPQPLDVLKKLRTLHLYRLKYGEISAIGALITLEILRIETDWDSYLKELPIEIGRLRNLRVLNLSSMSSLRYIPLGVLSKMSNLEELYVSTKFMAWGLIEDGKENASLKELESHPITALEIYVFNFLVFPKEWVISNLSRFKVVIGTHFKYNSYGKDSMNELYIEGDGNDVLASGFSALLRNTEVLGLKVNNLKNCLLELEDEGSEETSQLRNKDLCFYKLKDVRIFESHEMKYVFPLSMARGLKQLQSINIKYCDEIEGIFYGKEEDDEKIISKDDDSDIEFPQLKMLYLYNLPKLIGFWIHKDKVLSDISKQSSASHINEKTRIGPSLFSSHRLQLPNLQELNLRDCGLLKVVFSTSIAGQLMQLKKLTLRRCKRIEYVVAGGEEDHKRKTKIVFPMLMSIYFSELPELVAFYPDGHTSFGSLNELKVRNCPKMKTFPSIYPSVDSTVQWQSSN

Gene3D: G3DSA:3.80.10.10
493-674 G3DSA:3.80.10.10

LVCCNSNMKSWPAEMDRYKNFTAISLVRIKIDEHLVDLECPKLQLLQLWCENDSQPLPNNSFGGMKELKVLSLEIPLLPQPLDVLKKLRTLHLYRLKYGEISAIGALITLEILRIETDWDSYLKELPIEIGRLRNLRVLNLSSMSSLRYIPLGVLSKMSNLEELYVSTKFMAWGLIEDGKEN

FPrintScan: PR00364
IPR000767
623-639 DISEASERSIST
Disease resistance protein

GRLRNLRVLNLSSMSSL

Gene3D: G3DSA:3.80.10.10
761-762 G3DSA:3.80.10.10

NL

Gene3D: G3DSA:3.80.10.10
781-949 G3DSA:3.80.10.10

RNKDLCFYKLKDVRIFESHEMKYVFPLSMARGLKQLQSINIKYCDEIEGIFYGKEEDDEKIISKDDDSDIEFPQLKMLYLYNLPKLIGFWIHKDKVLSDISKQSSASHINEKTRIGPSLFSSHRLQLPNLQELNLRDCGLLKVVFSTSIAGQLMQLKKLTLRRCKRIEY

Gene3D: G3DSA:3.80.10.10
983-1011 G3DSA:3.80.10.10

FYPDGHTSFGSLNELKVRNCPKMKTFPSI

Gene3D: G3DSA:3.80.10.10
1061-1203 G3DSA:3.80.10.10

FKSIEALRNLNKLALFKNDEFEVIFSFEEWRSDGVMLSVLEKLELSFLPKLAHIWFKIPPEITAFQNLKELDVYDCSSLKYIFSPCAIKLLVRLEKVIVDECHGIEAIVAEEEEEEEEEESHRNIIFPQLRFLQLTSLTKLKS

superfamily: SSF52058
1067-1441 SSF52058,LRR

LRNLNKLALFKNDEFEVIFSFEEWRSDGVMLSVLEKLELSFLPKLAHIWFKIPPEITAFQNLKELDVYDCSSLKYIFSPCAIKLLVRLEKVIVDECHGIEAIVAEEEEEEEEEESHRNIIFPQLRFLQLTSLTKLKSFCSDRSTTVEFPLLEDLRLKNVGAMMEEKVQYQNKGEFGHSYSHAETCPPFTIRSIKRIRNLKRLEVGSCQSLEVIYLFEENHADGVLFNNLEELRLDFLPNFKHVLLKIPPEISAFQNLKKINIEYCDHLKYLFSPPVAKLLVKLEVVRIIECKMVEAMVAEEKLEAEARSDRIVFPRLRFLELQSLHKFKSFCIENSVTVELPLLEDLKLVHCHQIRTFSYGSVITPKLKTMRIDS

Gene3D: G3DSA:3.80.10.10
1254-1265 G3DSA:3.80.10.10

FTIRSIKRIRNL

Gene3D: G3DSA:3.80.10.10
1266-1270 G3DSA:3.80.10.10

KRLEV

Gene3D: G3DSA:3.80.10.10
1271-1438 G3DSA:3.80.10.10

GSCQSLEVIYLFEENHADGVLFNNLEELRLDFLPNFKHVLLKIPPEISAFQNLKKINIEYCDHLKYLFSPPVAKLLVKLEVVRIIECKMVEAMVAEEKLEAEARSDRIVFPRLRFLELQSLHKFKSFCIENSVTVELPLLEDLKLVHCHQIRTFSYGSVITPKLKTMR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox