PRGDB00062238 (Disease resistance protein RPP13, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RPP13, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255561551 (XM_002521740)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RPP13, putative, mRNA.

DNA Sequence

ATGGCTGAATCTGTAGTGTCAACAGTAGTGCTAAGACTTACTGACTTGCTCATTCAAGAAGCAACTTTCTTAGATGGAGTGACGGAAGAAGTTCTTGGCATGCAGCTTGAACTGAGACGGATGCAATCATTCTTGAAAGATGCAGATACAAGACAAGATGAAGAAAATATAGAGACTCTGCGCAATTGGGTTGCTGAAATCAGAGAAGCTGCTTATGATGTTGAAGATCTCATTGAAGAGTTTGCTCTCAAAGTTGCTTTGAGGAGTGGAAGATCAGGTGTTGTAAATGTCATCAAGAGATATGCTACTATTGCAAAAGAATCTGTAGAGCTTTACAAGGTTGGTTCTGAGATCCAAAACATTAAAACCAGGATTTCTGATCTGACTAGAAGCTTGGACACTTTTGGGATACAACCTAGAGAAAGCTCAGGTCCTTCTCTACCGGGCGGAAGGCAGAAAAATTTAAGGCGGTCATATTCACATATTGTTGAAGAAGATACAGTTGGCTTAGAAGAAGATGTGGAAATTTTGGTTGAGAAGTTGGTAGCTAGTGAGAAAAATGTTGTTTTCATTTACGGAATGGGCGGCCTCGGAAAGACTACTCTTGCTAAGAAGATTTATCATAATTCTGATGTTAGGCATCACTTTGATGCCTTTGCTTGGGCTTATATATCTCAGCAGTGTCAAATTAGGGATGTCTGGGAAGGAATTTTGTTTAAGTTGATCAATCCATCAAAAGAGCAGAGGGAAGAAATTTCAAGTCTAAGGGATGACGAGCTTGCTAGGAAGCTTTATCATGTCCAACAAGAGAAGAAATGTTTGGTGATCTTGGATGATATTTGGACTGCTGAGACTTGGACTAATCTGCGTCCTGCTTTTCCATATGAAATTGGAAAGTCTGGCAGCAAAATATTGCTCACAACTCGCATCAGAGATGTTACATTGCTTCCGGATCCGACGTGTTTTCGTCACCAACCAAGATACTTAAATGATGAAGAGAGCTGGGAACTGTTCAAACGGAAGGCATTTCTTGCCAGTAATTATCCAGACTTTAGAATTAGATCACCGGTGGAAAAGTTGGGAAGGGAAATGGTTGGCAAATGTACAGGTTTGCCATTGGCCATCATTGTGCTTGGAGGACTGCTGGCTAACAAAAAGAACATCCTTGAGTGGGATGCAGTGCGCCGAAGTATTGTTTCACATTTGAGGAGAGGTAAAGGCCATGAACCATGTGTATCTGAGGTTTTAGCTGTAAGTTACCATGAATTACCATATCAGGTGAAACCATGCTTCCTTCACTTGGCTCATTTCCCTGAAGATTATGAGATACCCACAAAGAAACTGATTCGGATGTGGGTTGCTGAGGGACTCATATCATGTGCGCACGATGAGGAAATGGAGGAGGAAACTATGGAAGATCTGGCTCAGAGCTACTTAGATGAGTTGGTTGAAAGGTGTATGGTTGAGGTAGTAAAGAGAGGCTCAACTGGAAGGATTAGAACCTGTCGAATGCATGATCTTATGCGAGGCCTATGCCTGTCAAAAGCAAAGCAGGAAAATTTCCTTGAGATTTTTAATCACTTGCATGTAAATGATCAGTCGGTCTACTCTTTTCCTTCATCTATGCTGAGTGGAGAAAGGTCTATTGGCAGACTTCGTAGGCTTGCTATCTTTTCTGATGGCGACCTTAAAAGATTTGTCCCCTCAAGATTCAGAAGGAATTCTCATCTCAGGTCTCTTTTGTATTTCCATGAAAAAGCATGTCGTGTAGAGAAATGGGGATCAATAAATTCATTGTTTAGTAACTTTCAGCTGCTCAGGGTCTTAGATCTTGATGGAATTCAGGGTCATAACGGAAAATTACCAAAGGGTATTGGAAAGCTGATTCATTTGAGATTCTTGAGCCTGAGAGATACTGATATAGATGAACTGCCATTGGCAATAGGCAACTTGAGGTATTTGCAAACTCTAGACCTTTTGACATGGAATTCTACTGTACGAATCCCAAATGTGATATGCAAGATGCAAAGACTGAGGCATTTATATCTTCCTGAGTCATGCGGTGATGATTCTGATAGATGGCAGTTGGCAAATTTGAGCAACCTGCAGACACTAGTGAACTTTCCTGCAGAAAAATGTGATATAAGAGATCTGTTAAGTTTGACCAATCTCAGGAAACTAGTAATAGATGATCCGAACTTCGGACTGATCTTCAGATCTCCTGGTACTTCATTTAATCATTTGGAGTCTCTATCCTTTGTTAGCAATGAAGATTATACACTAGTTCAAATTATAACAGGCTGTCCTAATCTTTATAAGCTGCATATTGAGGGGCAGATAGAGAAGCTACCCGAGTGCCATCAGTTTTCTTCAAACCTTGCCAAATTAAACCTGCAAGGATCTAAGCTACTGGAAGATCCAATGATGACTCTGGAGAAGCTACCGAACTTAAGAATCCTCCGGTTGCAAATGGATTCATTCCTGGGGACATTGATGGTTTGCTCTGACAAAGGGTTTCCTCAACTGAAGTCCTTGCTCCTTTGTGACTTGCCCAACTTAGAGGACTGGAAGGTGGAAGAAGGAGCCATGTCTAATCTTTGCCATTTAGAGATTTCGAATTGCACATCTATGAAGATGGTTCCTGATGGGCTAAGGTTCATCACTTGCCTTCAGGAAATGGAGATTCGATCGATGCTTAAAGCATTCAAAACCAGACTTGAGGAGGGAGGAGATGATTACTACAAAGTCCAACACGTACCTTCTGTTTTGTTTCAGTATTGTGATTATTAG


Protein sequences

Name Description Sequence
Disease resistance protein RPP13, putative Disease resistance protein RPP13, putative [Ricinus communis].

MAESVVSTVVLRLTDLLIQEATFLDGVTEEVLGMQLELRRMQSFLKDADTRQDEENIETLRNWVAEIREAAYDVEDLIEEFALKVALRSGRSGVVNVIKRYATIAKESVELYKVGSEIQNIKTRISDLTRSLDTFGIQPRESSGPSLPGGRQKNLRRSYSHIVEEDTVGLEEDVEILVEKLVASEKNVVFIYGMGGLGKTTLAKKIYHNSDVRHHFDAFAWAYISQQCQIRDVWEGILFKLINPSKEQREEISSLRDDELARKLYHVQQEKKCLVILDDIWTAETWTNLRPAFPYEIGKSGSKILLTTRIRDVTLLPDPTCFRHQPRYLNDEESWELFKRKAFLASNYPDFRIRSPVEKLGREMVGKCTGLPLAIIVLGGLLANKKNILEWDAVRRSIVSHLRRGKGHEPCVSEVLAVSYHELPYQVKPCFLHLAHFPEDYEIPTKKLIRMWVAEGLISCAHDEEMEEETMEDLAQSYLDELVERCMVEVVKRGSTGRIRTCRMHDLMRGLCLSKAKQENFLEIFNHLHVNDQSVYSFPSSMLSGERSIGRLRRLAIFSDGDLKRFVPSRFRRNSHLRSLLYFHEKACRVEKWGSINSLFSNFQLLRVLDLDGIQGHNGKLPKGIGKLIHLRFLSLRDTDIDELPLAIGNLRYLQTLDLLTWNSTVRIPNVICKMQRLRHLYLPESCGDDSDRWQLANLSNLQTLVNFPAEKCDIRDLLSLTNLRKLVIDDPNFGLIFRSPGTSFNHLESLSFVSNEDYTLVQIITGCPNLYKLHIEGQIEKLPECHQFSSNLAKLNLQGSKLLEDPMMTLEKLPNLRILRLQMDSFLGTLMVCSDKGFPQLKSLLLCDLPNLEDWKVEEGAMSNLCHLEISNCTSMKMVPDGLRFITCLQEMEIRSMLKAFKTRLEEGGDDYYKVQHVPSVLFQYCDY

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
9-898 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VVLRLTDLLIQEATFLDGVTEEVLGMQLELRRMQSFLKDADTRQDEENIETLRNWVAEIREAAYDVEDLIEEFALKVALRSGRSGVVNVIKRYATIAKESVELYKVGSEIQNIKTRISDLTRSLDTFGIQPRESSGPSLPGGRQKNLRRSYSHIVEEDTVGLEEDVEILVEKLVASEKNVVFIYGMGGLGKTTLAKKIYHNSDVRHHFDAFAWAYISQQCQIRDVWEGILFKLINPSKEQREEISSLRDDELARKLYHVQQEKKCLVILDDIWTAETWTNLRPAFPYEIGKSGSKILLTTRIRDVTLLPDPTCFRHQPRYLNDEESWELFKRKAFLASNYPDFRIRSPVEKLGREMVGKCTGLPLAIIVLGGLLANKKNILEWDAVRRSIVSHLRRGKGHEPCVSEVLAVSYHELPYQVKPCFLHLAHFPEDYEIPTKKLIRMWVAEGLISCAHDEEMEEETMEDLAQSYLDELVERCMVEVVKRGSTGRIRTCRMHDLMRGLCLSKAKQENFLEIFNHLHVNDQSVYSFPSSMLSGERSIGRLRRLAIFSDGDLKRFVPSRFRRNSHLRSLLYFHEKACRVEKWGSINSLFSNFQLLRVLDLDGIQGHNGKLPKGIGKLIHLRFLSLRDTDIDELPLAIGNLRYLQTLDLLTWNSTVRIPNVICKMQRLRHLYLPESCGDDSDRWQLANLSNLQTLVNFPAEKCDIRDLLSLTNLRKLVIDDPNFGLIFRSPGTSFNHLESLSFVSNEDYTLVQIITGCPNLYKLHIEGQIEKLPECHQFSSNLAKLNLQGSKLLEDPMMTLEKLPNLRILRLQMDSFLGTLMVCSDKGFPQLKSLLLCDLPNLEDWKVEEGAMSNLCHLEISNCTSMKMVPDGLRFITCLQEMEIRSM

superfamily: SSF52540
150-404 SSF52540

GRQKNLRRSYSHIVEEDTVGLEEDVEILVEKLVASEKNVVFIYGMGGLGKTTLAKKIYHNSDVRHHFDAFAWAYISQQCQIRDVWEGILFKLINPSKEQREEISSLRDDELARKLYHVQQEKKCLVILDDIWTAETWTNLRPAFPYEIGKSGSKILLTTRIRDVTLLPDPTCFRHQPRYLNDEESWELFKRKAFLASNYPDFRIRSPVEKLGREMVGKCTGLPLAIIVLGGLLANKKNILEWDAVRRSIVSHLRR

Gene3D: G3DSA:3.40.50.300
162-288 G3DSA:3.40.50.300

IVEEDTVGLEEDVEILVEKLVASEKNVVFIYGMGGLGKTTLAKKIYHNSDVRHHFDAFAWAYISQQCQIRDVWEGILFKLINPSKEQREEISSLRDDELARKLYHVQQEKKCLVILDDIWTAETWTN

HMMPfam: PF00931
IPR002182
171-460 NB-ARC,NBS
NB-ARC

EEDVEILVEKLVASEKNVVFIYGMGGLGKTTLAKKIYHNSDVRHHFDAFAWAYISQQCQIRDVWEGILFKLINPSKEQREEISSLRDDELARKLYHVQQEKKCLVILDDIWTAETWTNLRPAFPYEIGKSGSKILLTTRIRDVTLLPDPTCFRHQPRYLNDEESWELFKRKAFLASNYPDFRIRSPVEKLGREMVGKCTGLPLAIIVLGGLLANKKNILEWDAVRRSIVSHLRRGKGHEPCVSEVLAVSYHELPYQVKPCFLHLAHFPEDYEIPTKKLIRMWVAEGLISC

FPrintScan: PR00364
IPR000767
188-203 DISEASERSIST
Disease resistance protein

VVFIYGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
267-281 DISEASERSIST
Disease resistance protein

VQQEKKCLVILDDIW

FPrintScan: PR00364
IPR000767
368-382 DISEASERSIST
Disease resistance protein

CTGLPLAIIVLGGLL

superfamily: SSF52058
503-897 SSF52058,LRR

RMHDLMRGLCLSKAKQENFLEIFNHLHVNDQSVYSFPSSMLSGERSIGRLRRLAIFSDGDLKRFVPSRFRRNSHLRSLLYFHEKACRVEKWGSINSLFSNFQLLRVLDLDGIQGHNGKLPKGIGKLIHLRFLSLRDTDIDELPLAIGNLRYLQTLDLLTWNSTVRIPNVICKMQRLRHLYLPESCGDDSDRWQLANLSNLQTLVNFPAEKCDIRDLLSLTNLRKLVIDDPNFGLIFRSPGTSFNHLESLSFVSNEDYTLVQIITGCPNLYKLHIEGQIEKLPECHQFSSNLAKLNLQGSKLLEDPMMTLEKLPNLRILRLQMDSFLGTLMVCSDKGFPQLKSLLLCDLPNLEDWKVEEGAMSNLCHLEISNCTSMKMVPDGLRFITCLQEMEIRS

Gene3D: G3DSA:3.80.10.10
527-697 G3DSA:3.80.10.10

HLHVNDQSVYSFPSSMLSGERSIGRLRRLAIFSDGDLKRFVPSRFRRNSHLRSLLYFHEKACRVEKWGSINSLFSNFQLLRVLDLDGIQGHNGKLPKGIGKLIHLRFLSLRDTDIDELPLAIGNLRYLQTLDLLTWNSTVRIPNVICKMQRLRHLYLPESCGDDSDRWQLA

Gene3D: G3DSA:3.80.10.10
698-896 G3DSA:3.80.10.10

NLSNLQTLVNFPAEKCDIRDLLSLTNLRKLVIDDPNFGLIFRSPGTSFNHLESLSFVSNEDYTLVQIITGCPNLYKLHIEGQIEKLPECHQFSSNLAKLNLQGSKLLEDPMMTLEKLPNLRILRLQMDSFLGTLMVCSDKGFPQLKSLLLCDLPNLEDWKVEEGAMSNLCHLEISNCTSMKMVPDGLRFITCLQEMEIR

FPrintScan: PR00364
IPR000767
861-877 DISEASERSIST
Disease resistance protein

GAMSNLCHLEISNCTSM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox