PRGDB00062247 (Disease resistance protein RFL1, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RFL1, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255553058 (XM_002517526)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RFL1, putative, mRNA.

DNA Sequence

ATGGGTAGTGTACTCTCCATCTCAATATCAATCTCGCCAATAGACCTTGTTGGCTGGTGGAAATTGCTTACTGGGCGAGCTAACAGGGTTGAGGGAAGACCAAGTGAACCAACTGTAGGTTTGGATACTATGTTACATAAGGTTTGGAACTGCCTCATGAAAGAAGATGTGGGAATTGTTGGCTTATACGGGATGGGAGGCATCGGTAAAACAACTGTCTTGACCCAAATCAACAACAAGTTCCTGAATAGGTCCCATGGTTTTGATGTTATTTGGATTACAGTGTCAAAAGATTTAAGACTTGAGAAGATTCAAGAAGAGATTGGGGAAAAGTTAGGCTTTTCGGATGATCAGAAATGGAAAAAAAGAATACTTGATGAGAAAGCTATAGACATCTATAATGTGTTACGGAAGAAGAAGTTTTTATTGCTGTTAGATGATATATGGGAGCGAGTTAACCTGATAAGATTAGGGATCCCTCGGCCGGATGGGAAAAACAGGTCCAAGGTAGTATTCACAACTCGTTCTGAGATGGTATGCAGCCAAATGGATGCTCACAAGAAGATTAAAGTGGAGACTTTGGCCTGGACCGAAGCTTGGAAACTGTTTCAGGATAAGGTTGGGGAAGACAACCTTAACATACATCCTGATATTCCTCACCTAGCTCAAGCTGTTGCTAGAGAGTGCGATGGTTTGCCAATAGCACTCATTACCATTGCTCGTGCTATGGCCTGCAAGAAGACACCTCAGGAATGGAATCATGCCCTTGAGGTCTTGAGAAAATCTGCCTCAGAACTACAAGGTATGAGTGAAGAGGTCTTTGCACTTTTGAAGTTCAGTTATGATAGTTTGCCAAATAAGAGACTTCAATCTTGTTTCTTATATTGTGCCTTGTTTCCTGAAGATTTTAAAATTGATAAGGATGACCTGATAGATTACTGGAATTGTGACGTAATCTGGAACCATCATGATGGCGGTAGTACTCCAAGTAGTGAGGGATCCAATAGCAGGAGCACCCTTTTGCTTGCACACTTATTGAAAGATGAAACTTATTGTGCACGTAACGAAGGGTATGAAATAATTGGTACTCTTGTTCGTGCATGCTTACTGGAAGAAGAAGGCAAATACGTGAAAGTTCATGATGTGATTCGCGACATGGCTCTGTGGATTGCCTCCAACTGTGCAGAGGAAAAAGAACAATTTCTGGTGCAAGCAGGCGTTCAATTAAGTAAAGCACCAAAAATTGAAAAATGGGAAGGGGTGAACAGGGTGTCACTGATGGCAAACTCCTTTTATGATCTTCCGGAAAAGCCTGTGTGTGCAAATCTGTTGACTTTATTTCTCTGTCACAATCCGGATTTGCGCATGATCACCAGTGAGTTCTTCCAGTTCATGGATGCACTAACAGTTCTAGACTTATCAAAGACTGGAATAATGGAATTACCTCTTGGAATTTCGAAATTGGTTTCGTTGCAATATCTCAATCTTTCAGATACATCGTTGACACAATTGTCTGTTGAATTAAGCAGGCTGAAGAAACTGAAGTATTTGAACTTGGAGCGGAACGGACGCCTAAAAATGATTCCAGGGCAAGTACTATCTAATCTTTCTGCATTGCAAGTTCTGAGAATGCTTAGATGCGGTAGTCATTTGTATGAAAAGGCAAAAGATAATCTACTGGCTGATGGTAAATTGCAAATAGAGGAGCTACAGAGTTTGGAGAATCTGAATGAGTTGAGCATCACAATCAATTTTTCCTCTATTCTACAGAGCTTCTTCAACATGGACAGATTTCTGAACTGTACTCGAGCTTTACTCCTAATGTGCTTTGATGCTCCAAGGTCCGTAGATATTTCATTCTTAGCAAATATGAAGAATCTAGGCATCCTGGAAATCCTAGCTAATTCTTCCCTCGAAGTGCTAGATGTTGGTATTTTGACGCAAGGAACATCACAAGTGCCCTCTGTCATATCAAGTAAGAAATGCTTCGACAGCCTTCAAAGAGTAGTTGTGTATAATTGTCGTAAGTTGAGGGAGTTGACATGGCTTAGTCTAGCTCCTAATTTGGCAATTCTGAGAGTTAAGTATAACGAAAATATGGAAGAAATCTTCAGCGTCAGAATATTGATTGAATTTGCTATCAGAGGGAGTATTAATCTAAAACCACTGGCAAAACTCGAATTTCTTGAACTGGGTAAATTACCAAGGCTGGAGAGTGTACATCCAAATGCACTCTCCTTTCCTTTTCTAAAGAAAATTAAGGTATTTAAATGCCCAAAGCTCAAGAAACTTCCATTAAATTCTAGCAGTGTAAAGGGAAGTGAAGTTGTGATTGAGGCAGAGGCAAAATGGTGGGAAGATGTTGAATGGGAGGATGATGCTACTAAAGCTGCCTTTCTACCCCATTTCACGCATTACACAACTCGACAGAGGATGTGA


Protein sequences

Name Description Sequence
Disease resistance protein RFL1, putative Disease resistance protein RFL1, putative [Ricinus communis].

MGSVLSISISISPIDLVGWWKLLTGRANRVEGRPSEPTVGLDTMLHKVWNCLMKEDVGIVGLYGMGGIGKTTVLTQINNKFLNRSHGFDVIWITVSKDLRLEKIQEEIGEKLGFSDDQKWKKRILDEKAIDIYNVLRKKKFLLLLDDIWERVNLIRLGIPRPDGKNRSKVVFTTRSEMVCSQMDAHKKIKVETLAWTEAWKLFQDKVGEDNLNIHPDIPHLAQAVARECDGLPIALITIARAMACKKTPQEWNHALEVLRKSASELQGMSEEVFALLKFSYDSLPNKRLQSCFLYCALFPEDFKIDKDDLIDYWNCDVIWNHHDGGSTPSSEGSNSRSTLLLAHLLKDETYCARNEGYEIIGTLVRACLLEEEGKYVKVHDVIRDMALWIASNCAEEKEQFLVQAGVQLSKAPKIEKWEGVNRVSLMANSFYDLPEKPVCANLLTLFLCHNPDLRMITSEFFQFMDALTVLDLSKTGIMELPLGISKLVSLQYLNLSDTSLTQLSVELSRLKKLKYLNLERNGRLKMIPGQVLSNLSALQVLRMLRCGSHLYEKAKDNLLADGKLQIEELQSLENLNELSITINFSSILQSFFNMDRFLNCTRALLLMCFDAPRSVDISFLANMKNLGILEILANSSLEVLDVGILTQGTSQVPSVISSKKCFDSLQRVVVYNCRKLRELTWLSLAPNLAILRVKYNENMEEIFSVRILIEFAIRGSINLKPLAKLEFLELGKLPRLESVHPNALSFPFLKKIKVFKCPKLKKLPLNSSSVKGSEVVIEAEAKWWEDVEWEDDATKAAFLPHFTHYTTRQRM

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
20-266 SSF52540

WKLLTGRANRVEGRPSEPTVGLDTMLHKVWNCLMKEDVGIVGLYGMGGIGKTTVLTQINNKFLNRSHGFDVIWITVSKDLRLEKIQEEIGEKLGFSDDQKWKKRILDEKAIDIYNVLRKKKFLLLLDDIWERVNLIRLGIPRPDGKNRSKVVFTTRSEMVCSQMDAHKKIKVETLAWTEAWKLFQDKVGEDNLNIHPDIPHLAQAVARECDGLPIALITIARAMACKKTPQEWNHALEVLRKSASEL

HMMPanther: PTHR23155:SF108
26-801 PTHR23155:SF108,SUBFAMILY NOT NAMED

RANRVEGRPSEPTVGLDTMLHKVWNCLMKEDVGIVGLYGMGGIGKTTVLTQINNKFLNRSHGFDVIWITVSKDLRLEKIQEEIGEKLGFSDDQKWKKRILDEKAIDIYNVLRKKKFLLLLDDIWERVNLIRLGIPRPDGKNRSKVVFTTRSEMVCSQMDAHKKIKVETLAWTEAWKLFQDKVGEDNLNIHPDIPHLAQAVARECDGLPIALITIARAMACKKTPQEWNHALEVLRKSASELQGMSEEVFALLKFSYDSLPNKRLQSCFLYCALFPEDFKIDKDDLIDYWNCDVIWNHHDGGSTPSSEGSNSRSTLLLAHLLKDETYCARNEGYEIIGTLVRACLLEEEGKYVKVHDVIRDMALWIASNCAEEKEQFLVQAGVQLSKAPKIEKWEGVNRVSLMANSFYDLPEKPVCANLLTLFLCHNPDLRMITSEFFQFMDALTVLDLSKTGIMELPLGISKLVSLQYLNLSDTSLTQLSVELSRLKKLKYLNLERNGRLKMIPGQVLSNLSALQVLRMLRCGSHLYEKAKDNLLADGKLQIEELQSLENLNELSITINFSSILQSFFNMDRFLNCTRALLLMCFDAPRSVDISFLANMKNLGILEILANSSLEVLDVGILTQGTSQVPSVISSKKCFDSLQRVVVYNCRKLRELTWLSLAPNLAILRVKYNENMEEIFSVRILIEFAIRGSINLKPLAKLEFLELGKLPRLESVHPNALSFPFLKKIKVFKCPKLKKLPLNSSSVKGSEVVIEAEAKWWEDVEWEDDATKAAFLP

HMMPanther: PTHR23155
26-801 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RANRVEGRPSEPTVGLDTMLHKVWNCLMKEDVGIVGLYGMGGIGKTTVLTQINNKFLNRSHGFDVIWITVSKDLRLEKIQEEIGEKLGFSDDQKWKKRILDEKAIDIYNVLRKKKFLLLLDDIWERVNLIRLGIPRPDGKNRSKVVFTTRSEMVCSQMDAHKKIKVETLAWTEAWKLFQDKVGEDNLNIHPDIPHLAQAVARECDGLPIALITIARAMACKKTPQEWNHALEVLRKSASELQGMSEEVFALLKFSYDSLPNKRLQSCFLYCALFPEDFKIDKDDLIDYWNCDVIWNHHDGGSTPSSEGSNSRSTLLLAHLLKDETYCARNEGYEIIGTLVRACLLEEEGKYVKVHDVIRDMALWIASNCAEEKEQFLVQAGVQLSKAPKIEKWEGVNRVSLMANSFYDLPEKPVCANLLTLFLCHNPDLRMITSEFFQFMDALTVLDLSKTGIMELPLGISKLVSLQYLNLSDTSLTQLSVELSRLKKLKYLNLERNGRLKMIPGQVLSNLSALQVLRMLRCGSHLYEKAKDNLLADGKLQIEELQSLENLNELSITINFSSILQSFFNMDRFLNCTRALLLMCFDAPRSVDISFLANMKNLGILEILANSSLEVLDVGILTQGTSQVPSVISSKKCFDSLQRVVVYNCRKLRELTWLSLAPNLAILRVKYNENMEEIFSVRILIEFAIRGSINLKPLAKLEFLELGKLPRLESVHPNALSFPFLKKIKVFKCPKLKKLPLNSSSVKGSEVVIEAEAKWWEDVEWEDDATKAAFLP

HMMPfam: PF00931
IPR002182
42-320 NB-ARC,NBS
NB-ARC

DTMLHKVWNCLMKEDVGIVGLYGMGGIGKTTVLTQINNKFLNRSHGFDVIWITVSKDLRLEKIQEEIGEKLGFSDDQKWKKRILDEKAIDIYNVLRKKKFLLLLDDIWERVNLIRLGIPRPDGKNRSKVVFTTRSEMVCSQMDAHKKIKVETLAWTEAWKLFQDKVGEDNLNIHPDIPHLAQAVARECDGLPIALITIARAMACKKTPQEWNHALEVLRKSASELQGMSEEVFALLKFSYDSLPNKRLQSCFLYCALFPEDFKIDKDDLIDYWNCDVIW

Gene3D: G3DSA:3.40.50.300
55-181 G3DSA:3.40.50.300

EDVGIVGLYGMGGIGKTTVLTQINNKFLNRSHGFDVIWITVSKDLRLEKIQEEIGEKLGFSDDQKWKKRILDEKAIDIYNVLRKKKFLLLLDDIWERVNLIRLGIPRPDGKNRSKVVFTTRSEMVCS

FPrintScan: PR00364
IPR000767
59-74 DISEASERSIST
Disease resistance protein

IVGLYGMGGIGKTTVL

FPrintScan: PR00364
IPR000767
135-149 DISEASERSIST
Disease resistance protein

VLRKKKFLLLLDDIW

FPrintScan: PR00364
IPR000767
229-243 DISEASERSIST
Disease resistance protein

CDGLPIALITIARAM

superfamily: SSF52058
378-765 SSF52058,LRR

KVHDVIRDMALWIASNCAEEKEQFLVQAGVQLSKAPKIEKWEGVNRVSLMANSFYDLPEKPVCANLLTLFLCHNPDLRMITSEFFQFMDALTVLDLSKTGIMELPLGISKLVSLQYLNLSDTSLTQLSVELSRLKKLKYLNLERNGRLKMIPGQVLSNLSALQVLRMLRCGSHLYEKAKDNLLADGKLQIEELQSLENLNELSITINFSSILQSFFNMDRFLNCTRALLLMCFDAPRSVDISFLANMKNLGILEILANSSLEVLDVGILTQGTSQVPSVISSKKCFDSLQRVVVYNCRKLRELTWLSLAPNLAILRVKYNENMEEIFSVRILIEFAIRGSINLKPLAKLEFLELGKLPRLESVHPNALSFPFLKKIKVFKCPKLKKLP

Gene3D: G3DSA:3.80.10.10
416-596 G3DSA:3.80.10.10

EKWEGVNRVSLMANSFYDLPEKPVCANLLTLFLCHNPDLRMITSEFFQFMDALTVLDLSKTGIMELPLGISKLVSLQYLNLSDTSLTQLSVELSRLKKLKYLNLERNGRLKMIPGQVLSNLSALQVLRMLRCGSHLYEKAKDNLLADGKLQIEELQSLENLNELSITINFSSILQSFFNMD

HMMPfam: PF12799
490-523 LRR_4,Leucine Rich repeats (2 copies)

SLQYLNLSDTSLTQLSVELSRLKKLKYLNLERNG

FPrintScan: PR00364
IPR000767
509-525 DISEASERSIST
Disease resistance protein

SRLKKLKYLNLERNGRL

Gene3D: G3DSA:3.80.10.10
665-773 G3DSA:3.80.10.10

SLQRVVVYNCRKLRELTWLSLAPNLAILRVKYNENMEEIFSVRILIEFAIRGSINLKPLAKLEFLELGKLPRLESVHPNALSFPFLKKIKVFKCPKLKKLPLNSSSVKG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox