PRGDB00062248 (Disease resistance protein RPS5, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RPS5, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255552974 (XM_002517484)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RPS5, putative, mRNA.

DNA Sequence

ATGGAATTGGTGAGTCCAATCTTGGATATTGGGAGATGTTTGTGGCAATCAGCTTCAACACGCGCAGCCTTCTTGCTTCACTTGGAAAAAAATTCGGATTCCTTAGAAATTGCGATCGATCAACTGAAGAACCTAAGAGACGATGTAATCACAAGGGTTGAAGAACAAGAAGATAAACAGCAGATGGAGCGTACAAAACGAGTGTCAGACTGGCTTGCTAAAGTAGAACAAATGGAAGCACAAGTGACTAAAGTTTTACAACAGGGCAAAGAAGTAGTTGGAAAGAAATGTCTTCTATTTTGTTGCCCCAGGAACTGCAGGGCAAGCTACAAGCTGGGAAAGAAAGTAAGCAAGATGATCGGCGAAGTGGATAAACTAAAGAAACCAGGGGATTTTGATGTTTTGGCTTACAGATTGCCTCGTGCTCCTGTTGATGAGATGCCTATGGAAAAGACAGTAGGTTTGGATTCAATGTTTGAAAAGGTTTGGAGAAGCATTGAAGACAAGAGTTCAGGAATTATTGGGTTGTATGGATTAGGGGGTGTGGGAAAAACAACTCTCCTGAAAAAAATTAACAACCAGTTCTCAAACACTACCCATGATTTTGATGTTGTAATTTGGGTTGCTGTATCCAAGCAAATAAATGTAGAAAATATCCAAGAAGTCATCAGGAACAAATTGGAGATCGGAAATAGCATTTGGATAAACAGAAGTGATGAACTTGAGAGAGCTATAGAAATATATAGAGTCTTGAGAAGAAAGAAATTTGTGTTGCTGTTGGATGATGTATGGGAAAGATTAGATCTTTCAAAAGTGGGAGTTCCTTTTCCAGGCAATAATAATGAGTCGAGAGTGATATTCACAACTCGATCAGAGGAGGTTTGTGGATACATGGAAGCTGACAGAAGGTTCAGAGTGGAGTGTTTGGCAGAACAAGATGCCTTGAATTTGTTTCAAAAGATGGTCGGTGAAGACACTCTAAGTTCTCATCAAGAAATCCCTCAGTTGGCACAAATTGTTGCTAAAAAATGCCAAGGCTTGCCACTAGCTCTTATAACAACTGGTCGAGCTATGGCTAGTAGAAAGAAACCACAGGAGTGGAAGTATGCAATGAAGGCATTGCAAAGCTATCCTTCAAAGTTCTCAGGTATGGAGGATCATGTCTTTCCAATTCTTAAGTTTAGTTATGATAGCTTGAATGACGAAACCGTGAAAACATGTTTCCTATATTGTTCTCTATTTCCTGAAGATCACATTATTCTAAAAGAGGAACTTATTAACCTTTGGATTGGAGAGGGGTTTTTAGACAAATTTGATGACATACATGATGCTAGGATTGAAGGAGAGTATATAATTGGAAGCTTGAAGCTCGCAGGCCTACTAGAGGGTGATGAACTAGAAGAGCATCTGGGTGTATCAACAGAGTGTGTTTGGTTGCATGATGTGATTCGCGATATGGCTTTGTGGTTAGCTTGTGAACATGGGAAGGAGACCAAAATTTTAGTGAGAGATCAACCTGGACGGATCAATTTAGATCAGAATCAAGTTAAAGAAGTGGAGAAGATATCAATGTGGAGTCATCATGTCAATGTAATCGAAGGTTTTCTAATTTTTCCCAACCTTCAAACTCTAATTTTGAGGAATTCTCGTTTGATCTCCATTCCAAGTGAAGTCATACTATGTGTTCCAGGGCTGAAAGTGTTGGACTTATCAAGTAACCATGGATTGGCTGAATTGCCCGAGGGAATTGGAAAATTAATCAATTTGCATTATCTTAATCTCTCTTGGACAGCAATAAAAGAGATGTCAACTGAAATCAAGAAGTTGACAAAACTGAGATGCTTAGTGTTGGATAATACAAAATACCTTCAACTTATTGCAAAGGAAGTAATTTCAAGTCTTATCTCTTTGCAACGTTTTAGCAAGCTAGCCACAATTGATTTTCTCTATAATGAGTTCCTCAATGAAGTAGCTTTACTTGATGAGCTACAGAGCCTGAAAAACCTGAATGACTTGAGCATTAACTTGTCTACTTCAGATTCAGTTGAAAAGTTTTTCAACTCCCCAATATTACAAGGGTGCATTAGAGAACTAACTCTAGTGGAGTGTTCAGAAATGACATCTCTCGATATATCACTTTCCTCAATGACAAGAATGAAGCATCTAGAGAAGCTAGAACTAAGGTTCTGCCAGTCTATATCAGAGTTAAGAGTGCGTCCATGTCTTATCAGAAAGGCTAATCCATCCTTCAGCAGCCTACGCTTTCTGCACATTGGGTTGTGTCCAATCAGAGATTTGACATGGCTCATTTATGCTCCAAAGCTTGAGACTTTGGAGTTAGTTAACTGTGACTCAGTGAATGAAGTGATCAATGCCAATTGCGGGAATGTAAAAGTTGAAGCAGACCACAACATTTTCTCAAACCTTACAAAGTTGTATTTGGTAAAGCTACCAAATCTACATTGTATCTTCCATCGAGCTTTATCATTTCCTTCCCTTGAAAAGATGCATGTGTCGGAGTGTCCAAAGCTAAGGAAGCTTCCATTTGATTCAAATTCGAACAACACCTTGAATGTTATCAAAGGAGAGAGGAGCTGGTGGGATGGACTGCAATGGGACAATGAGGGTTTAAAGGATCTTCTCAGTTCAAAATTCGTCGAGGAATATTATACCATCACTGACTCTTTGATTTCATACCTCCGGGAGGAGCTACCAATGCTTTGCAATATCTTAAATCTTCCTCTCCTCGTGGCTCAGGTCACTCCTTTCTTCTCCAGCAATCAGTCTTGTGGTGGGATTAACTCTCTTGGTTCGATTAGTTGGTTTAAGCCTCCCCAGGGCTGGTTAATAGTTAATGCTGACGCTGCGACTTTTGGCCGAGAAAATAGAACAGGTTGGGGAATGATTGCTCGGGATGGTAGTGGTTATTTTATTGCAGCTAGAGCTCTGTCACTAGATGGTTGCTTTGAGGTTAGAGATGCTGAGGCAATGGGTGTGCGTGAAGCTTTAAGTTGGGCTAACCAAATGGGGTGGAATGCTGTTGTTCTGGAAATGGAGCATTGGTGGTTTTTCGGTCCTTACAGCAGCATCAAGGAACTGATACTTCCAGCTATGGTTTGGTCATTAATGATAGTTTACATTCTATTTCTGATTTTAAAGACTTTAGGCTCTCCTTTGTGCGGCATTCTGCAAACTGTGTAG


Protein sequences

Name Description Sequence
Disease resistance protein RPS5, putative Disease resistance protein RPS5, putative [Ricinus communis].

MELVSPILDIGRCLWQSASTRAAFLLHLEKNSDSLEIAIDQLKNLRDDVITRVEEQEDKQQMERTKRVSDWLAKVEQMEAQVTKVLQQGKEVVGKKCLLFCCPRNCRASYKLGKKVSKMIGEVDKLKKPGDFDVLAYRLPRAPVDEMPMEKTVGLDSMFEKVWRSIEDKSSGIIGLYGLGGVGKTTLLKKINNQFSNTTHDFDVVIWVAVSKQINVENIQEVIRNKLEIGNSIWINRSDELERAIEIYRVLRRKKFVLLLDDVWERLDLSKVGVPFPGNNNESRVIFTTRSEEVCGYMEADRRFRVECLAEQDALNLFQKMVGEDTLSSHQEIPQLAQIVAKKCQGLPLALITTGRAMASRKKPQEWKYAMKALQSYPSKFSGMEDHVFPILKFSYDSLNDETVKTCFLYCSLFPEDHIILKEELINLWIGEGFLDKFDDIHDARIEGEYIIGSLKLAGLLEGDELEEHLGVSTECVWLHDVIRDMALWLACEHGKETKILVRDQPGRINLDQNQVKEVEKISMWSHHVNVIEGFLIFPNLQTLILRNSRLISIPSEVILCVPGLKVLDLSSNHGLAELPEGIGKLINLHYLNLSWTAIKEMSTEIKKLTKLRCLVLDNTKYLQLIAKEVISSLISLQRFSKLATIDFLYNEFLNEVALLDELQSLKNLNDLSINLSTSDSVEKFFNSPILQGCIRELTLVECSEMTSLDISLSSMTRMKHLEKLELRFCQSISELRVRPCLIRKANPSFSSLRFLHIGLCPIRDLTWLIYAPKLETLELVNCDSVNEVINANCGNVKVEADHNIFSNLTKLYLVKLPNLHCIFHRALSFPSLEKMHVSECPKLRKLPFDSNSNNTLNVIKGERSWWDGLQWDNEGLKDLLSSKFVEEYYTITDSLISYLREELPMLCNILNLPLLVAQVTPFFSSNQSCGGINSLGSISWFKPPQGWLIVNADAATFGRENRTGWGMIARDGSGYFIAARALSLDGCFEVRDAEAMGVREALSWANQMGWNAVVLEMEHWWFFGPYSSIKELILPAMVWSLMIVYILFLILKTLGSPLCGILQTV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
28-911 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LEKNSDSLEIAIDQLKNLRDDVITRVEEQEDKQQMERTKRVSDWLAKVEQMEAQVTKVLQQGKEVVGKKCLLFCCPRNCRASYKLGKKVSKMIGEVDKLKKPGDFDVLAYRLPRAPVDEMPMEKTVGLDSMFEKVWRSIEDKSSGIIGLYGLGGVGKTTLLKKINNQFSNTTHDFDVVIWVAVSKQINVENIQEVIRNKLEIGNSIWINRSDELERAIEIYRVLRRKKFVLLLDDVWERLDLSKVGVPFPGNNNESRVIFTTRSEEVCGYMEADRRFRVECLAEQDALNLFQKMVGEDTLSSHQEIPQLAQIVAKKCQGLPLALITTGRAMASRKKPQEWKYAMKALQSYPSKFSGMEDHVFPILKFSYDSLNDETVKTCFLYCSLFPEDHIILKEELINLWIGEGFLDKFDDIHDARIEGEYIIGSLKLAGLLEGDELEEHLGVSTECVWLHDVIRDMALWLACEHGKETKILVRDQPGRINLDQNQVKEVEKISMWSHHVNVIEGFLIFPNLQTLILRNSRLISIPSEVILCVPGLKVLDLSSNHGLAELPEGIGKLINLHYLNLSWTAIKEMSTEIKKLTKLRCLVLDNTKYLQLIAKEVISSLISLQRFSKLATIDFLYNEFLNEVALLDELQSLKNLNDLSINLSTSDSVEKFFNSPILQGCIRELTLVECSEMTSLDISLSSMTRMKHLEKLELRFCQSISELRVRPCLIRKANPSFSSLRFLHIGLCPIRDLTWLIYAPKLETLELVNCDSVNEVINANCGNVKVEADHNIFSNLTKLYLVKLPNLHCIFHRALSFPSLEKMHVSECPKLRKLPFDSNSNNTLNVIKGERSWWDGLQWDNEGLKDLLSSKFVEEYYTITDSLISYLREELPMLCNIL

HMMPanther: PTHR23155:SF119
28-911 PTHR23155:SF119,RFL1 (RPS5-LIKE 1)

LEKNSDSLEIAIDQLKNLRDDVITRVEEQEDKQQMERTKRVSDWLAKVEQMEAQVTKVLQQGKEVVGKKCLLFCCPRNCRASYKLGKKVSKMIGEVDKLKKPGDFDVLAYRLPRAPVDEMPMEKTVGLDSMFEKVWRSIEDKSSGIIGLYGLGGVGKTTLLKKINNQFSNTTHDFDVVIWVAVSKQINVENIQEVIRNKLEIGNSIWINRSDELERAIEIYRVLRRKKFVLLLDDVWERLDLSKVGVPFPGNNNESRVIFTTRSEEVCGYMEADRRFRVECLAEQDALNLFQKMVGEDTLSSHQEIPQLAQIVAKKCQGLPLALITTGRAMASRKKPQEWKYAMKALQSYPSKFSGMEDHVFPILKFSYDSLNDETVKTCFLYCSLFPEDHIILKEELINLWIGEGFLDKFDDIHDARIEGEYIIGSLKLAGLLEGDELEEHLGVSTECVWLHDVIRDMALWLACEHGKETKILVRDQPGRINLDQNQVKEVEKISMWSHHVNVIEGFLIFPNLQTLILRNSRLISIPSEVILCVPGLKVLDLSSNHGLAELPEGIGKLINLHYLNLSWTAIKEMSTEIKKLTKLRCLVLDNTKYLQLIAKEVISSLISLQRFSKLATIDFLYNEFLNEVALLDELQSLKNLNDLSINLSTSDSVEKFFNSPILQGCIRELTLVECSEMTSLDISLSSMTRMKHLEKLELRFCQSISELRVRPCLIRKANPSFSSLRFLHIGLCPIRDLTWLIYAPKLETLELVNCDSVNEVINANCGNVKVEADHNIFSNLTKLYLVKLPNLHCIFHRALSFPSLEKMHVSECPKLRKLPFDSNSNNTLNVIKGERSWWDGLQWDNEGLKDLLSSKFVEEYYTITDSLISYLREELPMLCNIL

superfamily: SSF52540
132-374 SSF52540

FDVLAYRLPRAPVDEMPMEKTVGLDSMFEKVWRSIEDKSSGIIGLYGLGGVGKTTLLKKINNQFSNTTHDFDVVIWVAVSKQINVENIQEVIRNKLEIGNSIWINRSDELERAIEIYRVLRRKKFVLLLDDVWERLDLSKVGVPFPGNNNESRVIFTTRSEEVCGYMEADRRFRVECLAEQDALNLFQKMVGEDTLSSHQEIPQLAQIVAKKCQGLPLALITTGRAMASRKKPQEWKYAMKAL

HMMPfam: PF00931
IPR002182
157-438 NB-ARC,NBS
NB-ARC

SMFEKVWRSIEDKSSGIIGLYGLGGVGKTTLLKKINNQFSNTTHDFDVVIWVAVSKQINVENIQEVIRNKLEIGNSIWINRSDELERAIEIYRVLRRKKFVLLLDDVWERLDLSKVGVPFPGNNNESRVIFTTRSEEVCGYMEADRRFRVECLAEQDALNLFQKMVGEDTLSSHQEIPQLAQIVAKKCQGLPLALITTGRAMASRKKPQEWKYAMKALQSYPSKFSGMEDHVFPILKFSYDSLNDETVKTCFLYCSLFPEDHIILKEELINLWIGEGFLDKF

Gene3D: G3DSA:3.40.50.300
166-258 G3DSA:3.40.50.300

IEDKSSGIIGLYGLGGVGKTTLLKKINNQFSNTTHDFDVVIWVAVSKQINVENIQEVIRNKLEIGNSIWINRSDELERAIEIYRVLRRKKFVL

HMMSmart: SM00382
IPR003593
170-316 AAA,NBS
ATPase, AAA+ type, core

SSGIIGLYGLGGVGKTTLLKKINNQFSNTTHDFDVVIWVAVSKQINVENIQEVIRNKLEIGNSIWINRSDELERAIEIYRVLRRKKFVLLLDDVWERLDLSKVGVPFPGNNNESRVIFTTRSEEVCGYMEADRRFRVECLAEQDALN

FPrintScan: PR00364
IPR000767
173-188 DISEASERSIST
Disease resistance protein

IIGLYGLGGVGKTTLL

FPrintScan: PR00364
IPR000767
250-264 DISEASERSIST
Disease resistance protein

VLRRKKFVLLLDDVW

Gene3D: G3DSA:3.80.10.10
259-269 G3DSA:3.80.10.10

LLDDVWERLDL

FPrintScan: PR00364
IPR000767
344-358 DISEASERSIST
Disease resistance protein

CQGLPLALITTGRAM

superfamily: SSF52058
478-864 SSF52058,LRR

WLHDVIRDMALWLACEHGKETKILVRDQPGRINLDQNQVKEVEKISMWSHHVNVIEGFLIFPNLQTLILRNSRLISIPSEVILCVPGLKVLDLSSNHGLAELPEGIGKLINLHYLNLSWTAIKEMSTEIKKLTKLRCLVLDNTKYLQLIAKEVISSLISLQRFSKLATIDFLYNEFLNEVALLDELQSLKNLNDLSINLSTSDSVEKFFNSPILQGCIRELTLVECSEMTSLDISLSSMTRMKHLEKLELRFCQSISELRVRPCLIRKANPSFSSLRFLHIGLCPIRDLTWLIYAPKLETLELVNCDSVNEVINANCGNVKVEADHNIFSNLTKLYLVKLPNLHCIFHRALSFPSLEKMHVSECPKLRKLPFDSNSNNTLNVIKGER

Gene3D: G3DSA:3.80.10.10
517-673 G3DSA:3.80.10.10

KEVEKISMWSHHVNVIEGFLIFPNLQTLILRNSRLISIPSEVILCVPGLKVLDLSSNHGLAELPEGIGKLINLHYLNLSWTAIKEMSTEIKKLTKLRCLVLDNTKYLQLIAKEVISSLISLQRFSKLATIDFLYNEFLNEVALLDELQSLKNLNDLS

FPrintScan: PR00364
IPR000767
560-576 DISEASERSIST
Disease resistance protein

LCVPGLKVLDLSSNHGL

HMMPfam: PF12799
588-622 LRR_4,Leucine Rich repeats (2 copies)

NLHYLNLSWTAIKEMSTEIKKLTKLRCLVLDNTKY

Gene3D: G3DSA:3.80.10.10
674-853 G3DSA:3.80.10.10

INLSTSDSVEKFFNSPILQGCIRELTLVECSEMTSLDISLSSMTRMKHLEKLELRFCQSISELRVRPCLIRKANPSFSSLRFLHIGLCPIRDLTWLIYAPKLETLELVNCDSVNEVINANCGNVKVEADHNIFSNLTKLYLVKLPNLHCIFHRALSFPSLEKMHVSECPKLRKLPFDSNS

superfamily: SSF53098
IPR012337
947-1022 RNaseH_fold
Ribonuclease H-like

GWLIVNADAATFGRENRTGWGMIARDGSGYFIAARALSLDGCFEVRDAEAMGVREALSWANQMGWNAVVLEMEHWW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox