PRGDB00062249 (Disease resistance protein RPM1, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RPM1, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255544074 (XM_002513054)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RPM1, putative, mRNA.

DNA Sequence

ATGGCAATAGAAATATCCGTGTCCATTTTGATAGAGAAACTGAAAAATCTGTTATCAGAGAAAGAAATGATCGATTCAAAATTAAGGGCCCAAGTGAGTAGCTCCATGGAGGAGTGGGAACGGTTGCCGAGATTACTGAAAGACGCGGAGAAGGAGGAGGATAGCAAAGTGATGAAGCTGCTGCTCAATGTGTATTTTGTAGACGACATCATTGACAACGTGCTTCTCAAATCGTCCCTCAAGACAGGTTACCCTTTCTCCTTCCTCGTTCCTTCACGGAACCAATCCATTCTGAGCCAAAATATGGAGAAACTTTTTACAAATGTCACCGACTTCTGTTCCTCATCCAAACTACCCTTGGAACAACCAGAAAACGAGCCTACAGAACCAAAATTTGAAGTCGGGGAGCCATCCAACCGTCAATGGCAACGAATATCTTCTTTTATGGAAGAATCAGAGGCTATTGTTGGTCTAATAGATCAAAGAGACGACTTGGTTCAATTAGTCGTCAGCAGCCGCTTGTCGCCTTTTCTGATTTCAGTGGTCGGCGAGGGAGGCTCTGGTAAGACTACTTTAGTCAAGTCCATGTACGATAGTGTTGAAGTGAAGCAACATTTCGTTTGTTGTGCTTGGGTTTATGTCTCTGAAAAATTTGAAGTCCGAGATGTGTTGACCGGGATATTGAGACAAGTTACAGTTGTTAAAGATGAAGAAAAGTTGCCTCTTGAATCATTGCTAAAGAGGGTCCGGGATTTCTTTCTTTGGAAGAAATACCTCATAGTTTTGGATGACATTCCATCACCTGATGTTTGGAGCACCATCAAATATGCGTTTCCAAATTCAGCCAGGGCAGCCAGGAGGGTCATTCTTACCTTGCCTAAGATTGAAGTTGCGCGAGCTATTGATCCACGGATCTCCCTTTTCCAGATTCGCCGAATGAATCATGAAGAGAGTTGGGCACTTTTCCTGAAGAAGGTAAGAACAGCAGAAGATAACTCAATTAGAAGCTTGAAGGAGAACATCTTGAGTAAATGTGACGGTTTACCTCTTGCAATAGTTGCACTAGCTGGCTTGCTCTCTACTAGACCACCAAACCAATGGTCAAGACTCATCGACCAAGCTACTGTCGGTGCTGATCAATCCTCTTCTTCCTCCAACATCTTGGCTGCGGGCTTCCGAGACCTACTTCCGTCATTAAAGTCTTGTCTTCTTTACATGAGTCTGTTCCCCAAGTCGCGCGAGATCAAACTCCGGAGATTGTTTGGGTTGTGGCTTGCGGAGGGACTAACAACACCTATTGTTGGGGAAAGCAGCAAATCGATCAAAAAAGAAGATTTGGCGAAGAGCTACTTTGAAAAACTTGTCAGTAGAAATATGATTGAGGTTGTCAAATGGAGGCTAGATGGAAGCCCCAAAACATGCTATCTTTCCCCTACTCTGCATGAAGCCCTTTTTCATATTGCAGGAAAGATGGGATTTTTTCATGTCCATCCCCTCACCAGTAAAGACACACAACAGTTTAATGTCCGCAGGATTGCAGAATACTTAGACATCAACACATATCTTTCTTCAGACCCTACAATTCAAGATTTACGTTCTTATATATCTTTTAATAGCCGCAAAGGGGACACCCCTGCTGGCGGAGTGGACAAGCTTCTTAGGAAGATCATTGCTAAAAGAGGCTTTGGATTGCTCACGGTGCTCGATCTAGAGAATGTCCACAGACCCTCTCTCTCTGAGACGCTAGGAAAACTACTGCAACTAAAGTATTTAGGTTTGAGATGTACTTTTCTGGATTCAGTTCCAAAGTGCATTGGTAAACTACCTTGCTTGGAGACTTTAGATATGAAGCATACTAATATAACAACTCTGCCTATATCCATCTGGAAGGTGAAGAAGCTTCGGCATCTCTATATGAATGAGATTCATTTTGATATGTCTATGCAAAATCCATCCGCTGGTGGGTGTTTGCCAGATCTTCAGACTTTATCAGGGCTCTTAATAGGCAATAACAGCTCGGTGATCAAATTGCTAGAGGGATTGACTGGTCTAAGGAAACTAGGTTTGACATGCTACAAAGCATCACTTGAAAAAATAATTCAGTGGCTTCCTACACTGAAAAATCTCGAGTCATTGAAGTTAAGGTCAATAAATGAGTTGCATCAACCTTCAGATCTCAATTTGATTACGTTGAAGGAGAATGCAAAGCTCCAGGAACTGTACTTGCTTGGGAAGTTACCTAAAAATTTTGCTGTGCATCAACTTCCCCAAAATCTGAGAAATTTTACGCTGTCGGTGTCAAAGCTCCACGAAGATCCAATGCCAATTTTAGGGAAGCTGAATAACCTTCATATCCTCAGGTTCTTTGCCCACTCGTACCTGGGAAAAGAAATGGATTGCAGGAAGGGATTTCCTGAGCTTCGTGTCTTGAAATTGTGGATGTTAGAAGAACTCGAGGAGTGGACTGTGGAGGAAGGATCCATGCCTAAACTCAGAAAAGTAGAGATTAGGTGCTGCATACAGCTAAAGCAGCATCGTGGATTACAGCTGCTGGCTTCCCTCAAGAAACTAACTTTAACGGCTATGCCAGAAGATTTTGTAGCAGAAGTTAAAGCCAACCTAAGCCAGAATATAAAGATCAAGACAAAGAATTAG


Protein sequences

Name Description Sequence
Disease resistance protein RPM1, putative Disease resistance protein RPM1, putative [Ricinus communis].

MAIEISVSILIEKLKNLLSEKEMIDSKLRAQVSSSMEEWERLPRLLKDAEKEEDSKVMKLLLNVYFVDDIIDNVLLKSSLKTGYPFSFLVPSRNQSILSQNMEKLFTNVTDFCSSSKLPLEQPENEPTEPKFEVGEPSNRQWQRISSFMEESEAIVGLIDQRDDLVQLVVSSRLSPFLISVVGEGGSGKTTLVKSMYDSVEVKQHFVCCAWVYVSEKFEVRDVLTGILRQVTVVKDEEKLPLESLLKRVRDFFLWKKYLIVLDDIPSPDVWSTIKYAFPNSARAARRVILTLPKIEVARAIDPRISLFQIRRMNHEESWALFLKKVRTAEDNSIRSLKENILSKCDGLPLAIVALAGLLSTRPPNQWSRLIDQATVGADQSSSSSNILAAGFRDLLPSLKSCLLYMSLFPKSREIKLRRLFGLWLAEGLTTPIVGESSKSIKKEDLAKSYFEKLVSRNMIEVVKWRLDGSPKTCYLSPTLHEALFHIAGKMGFFHVHPLTSKDTQQFNVRRIAEYLDINTYLSSDPTIQDLRSYISFNSRKGDTPAGGVDKLLRKIIAKRGFGLLTVLDLENVHRPSLSETLGKLLQLKYLGLRCTFLDSVPKCIGKLPCLETLDMKHTNITTLPISIWKVKKLRHLYMNEIHFDMSMQNPSAGGCLPDLQTLSGLLIGNNSSVIKLLEGLTGLRKLGLTCYKASLEKIIQWLPTLKNLESLKLRSINELHQPSDLNLITLKENAKLQELYLLGKLPKNFAVHQLPQNLRNFTLSVSKLHEDPMPILGKLNNLHILRFFAHSYLGKEMDCRKGFPELRVLKLWMLEELEEWTVEEGSMPKLRKVEIRCCIQLKQHRGLQLLASLKKLTLTAMPEDFVAEVKANLSQNIKIKTKN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
3-877 PTHR23155:SF121,SUBFAMILY NOT NAMED

IEISVSILIEKLKNLLSEKEMIDSKLRAQVSSSMEEWERLPRLLKDAEKEEDSKVMKLLLNVYFVDDIIDNVLLKSSLKTGYPFSFLVPSRNQSILSQNMEKLFTNVTDFCSSSKLPLEQPENEPTEPKFEVGEPSNRQWQRISSFMEESEAIVGLIDQRDDLVQLVVSSRLSPFLISVVGEGGSGKTTLVKSMYDSVEVKQHFVCCAWVYVSEKFEVRDVLTGILRQVTVVKDEEKLPLESLLKRVRDFFLWKKYLIVLDDIPSPDVWSTIKYAFPNSARAARRVILTLPKIEVARAIDPRISLFQIRRMNHEESWALFLKKVRTAEDNSIRSLKENILSKCDGLPLAIVALAGLLSTRPPNQWSRLIDQATVGADQSSSSSNILAAGFRDLLPSLKSCLLYMSLFPKSREIKLRRLFGLWLAEGLTTPIVGESSKSIKKEDLAKSYFEKLVSRNMIEVVKWRLDGSPKTCYLSPTLHEALFHIAGKMGFFHVHPLTSKDTQQFNVRRIAEYLDINTYLSSDPTIQDLRSYISFNSRKGDTPAGGVDKLLRKIIAKRGFGLLTVLDLENVHRPSLSETLGKLLQLKYLGLRCTFLDSVPKCIGKLPCLETLDMKHTNITTLPISIWKVKKLRHLYMNEIHFDMSMQNPSAGGCLPDLQTLSGLLIGNNSSVIKLLEGLTGLRKLGLTCYKASLEKIIQWLPTLKNLESLKLRSINELHQPSDLNLITLKENAKLQELYLLGKLPKNFAVHQLPQNLRNFTLSVSKLHEDPMPILGKLNNLHILRFFAHSYLGKEMDCRKGFPELRVLKLWMLEELEEWTVEEGSMPKLRKVEIRCCIQLKQHRGLQLLASLKKLTLTAMPEDFVAEVKANLSQN

HMMPanther: PTHR23155
3-877 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IEISVSILIEKLKNLLSEKEMIDSKLRAQVSSSMEEWERLPRLLKDAEKEEDSKVMKLLLNVYFVDDIIDNVLLKSSLKTGYPFSFLVPSRNQSILSQNMEKLFTNVTDFCSSSKLPLEQPENEPTEPKFEVGEPSNRQWQRISSFMEESEAIVGLIDQRDDLVQLVVSSRLSPFLISVVGEGGSGKTTLVKSMYDSVEVKQHFVCCAWVYVSEKFEVRDVLTGILRQVTVVKDEEKLPLESLLKRVRDFFLWKKYLIVLDDIPSPDVWSTIKYAFPNSARAARRVILTLPKIEVARAIDPRISLFQIRRMNHEESWALFLKKVRTAEDNSIRSLKENILSKCDGLPLAIVALAGLLSTRPPNQWSRLIDQATVGADQSSSSSNILAAGFRDLLPSLKSCLLYMSLFPKSREIKLRRLFGLWLAEGLTTPIVGESSKSIKKEDLAKSYFEKLVSRNMIEVVKWRLDGSPKTCYLSPTLHEALFHIAGKMGFFHVHPLTSKDTQQFNVRRIAEYLDINTYLSSDPTIQDLRSYISFNSRKGDTPAGGVDKLLRKIIAKRGFGLLTVLDLENVHRPSLSETLGKLLQLKYLGLRCTFLDSVPKCIGKLPCLETLDMKHTNITTLPISIWKVKKLRHLYMNEIHFDMSMQNPSAGGCLPDLQTLSGLLIGNNSSVIKLLEGLTGLRKLGLTCYKASLEKIIQWLPTLKNLESLKLRSINELHQPSDLNLITLKENAKLQELYLLGKLPKNFAVHQLPQNLRNFTLSVSKLHEDPMPILGKLNNLHILRFFAHSYLGKEMDCRKGFPELRVLKLWMLEELEEWTVEEGSMPKLRKVEIRCCIQLKQHRGLQLLASLKKLTLTAMPEDFVAEVKANLSQN

superfamily: SSF52540
137-373 SSF52540

PSNRQWQRISSFMEESEAIVGLIDQRDDLVQLVVSSRLSPFLISVVGEGGSGKTTLVKSMYDSVEVKQHFVCCAWVYVSEKFEVRDVLTGILRQVTVVKDEEKLPLESLLKRVRDFFLWKKYLIVLDDIPSPDVWSTIKYAFPNSARAARRVILTLPKIEVARAIDPRISLFQIRRMNHEESWALFLKKVRTAEDNSIRSLKENILSKCDGLPLAIVALAGLLSTRPPNQWSRLIDQ

HMMPfam: PF00931
IPR002182
165-431 NB-ARC,NBS
NB-ARC

LVQLVVSSRLSPFLISVVGEGGSGKTTLVKSMYDSVEVKQHFVCCAWVYVSEKFEVRDVLTGILRQVTVVKDEEKLPLESLLKRVRDFFLWKKYLIVLDDIPSPDVWSTIKYAFPNSARAARRVILTLPKIEVARAIDPRISLFQIRRMNHEESWALFLKKVRTAEDNSIRSLKENILSKCDGLPLAIVALAGLLSTRPPNQWSRLIDQATVGADQSSSSSNILAAGFRDLLPSLKSCLLYMSLFPKSREIKLRRLFGLWLAEGLTT

Gene3D: G3DSA:3.40.50.300
176-308 G3DSA:3.40.50.300

PFLISVVGEGGSGKTTLVKSMYDSVEVKQHFVCCAWVYVSEKFEVRDVLTGILRQVTVVKDEEKLPLESLLKRVRDFFLWKKYLIVLDDIPSPDVWSTIKYAFPNSARAARRVILTLPKIEVARAIDPRISLF

FPrintScan: PR00364
IPR000767
178-193 DISEASERSIST
Disease resistance protein

LISVVGEGGSGKTTLV

FPrintScan: PR00364
IPR000767
252-266 DISEASERSIST
Disease resistance protein

FFLWKKYLIVLDDIP

FPrintScan: PR00364
IPR000767
345-359 DISEASERSIST
Disease resistance protein

CDGLPLAIVALAGLL

Gene3D: G3DSA:3.80.10.10
563-739 G3DSA:3.80.10.10

GLLTVLDLENVHRPSLSETLGKLLQLKYLGLRCTFLDSVPKCIGKLPCLETLDMKHTNITTLPISIWKVKKLRHLYMNEIHFDMSMQNPSAGGCLPDLQTLSGLLIGNNSSVIKLLEGLTGLRKLGLTCYKASLEKIIQWLPTLKNLESLKLRSINELHQPSDLNLITLKENAKLQE

superfamily: SSF52058
565-863 SSF52058,LRR

LTVLDLENVHRPSLSETLGKLLQLKYLGLRCTFLDSVPKCIGKLPCLETLDMKHTNITTLPISIWKVKKLRHLYMNEIHFDMSMQNPSAGGCLPDLQTLSGLLIGNNSSVIKLLEGLTGLRKLGLTCYKASLEKIIQWLPTLKNLESLKLRSINELHQPSDLNLITLKENAKLQELYLLGKLPKNFAVHQLPQNLRNFTLSVSKLHEDPMPILGKLNNLHILRFFAHSYLGKEMDCRKGFPELRVLKLWMLEELEEWTVEEGSMPKLRKVEIRCCIQLKQHRGLQLLASLKKLTLTAMP

FPrintScan: PR00364
IPR000767
606-622 DISEASERSIST
Disease resistance protein

GKLPCLETLDMKHTNIT

Gene3D: G3DSA:3.80.10.10
740-862 G3DSA:3.80.10.10

LYLLGKLPKNFAVHQLPQNLRNFTLSVSKLHEDPMPILGKLNNLHILRFFAHSYLGKEMDCRKGFPELRVLKLWMLEELEEWTVEEGSMPKLRKVEIRCCIQLKQHRGLQLLASLKKLTLTAM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox