PRGDB00062250 (Disease resistance protein RGA2, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RGA2, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255544070 (XM_002513052)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RGA2, putative, mRNA.

DNA Sequence

ATGGCGGAACTGGCAGGAGGAGCTTTTCTCTCTTCTTTCATGCAGATTCTATTTGATCGGTTAACTTTTAACGGGGCCCAGAAAGGGGCTCTTGTATTGAAGAGTTTAAAAGAAATAATGATGCTTATCAATCCAGTTCTCCTAGACGCAGAGGAGAAGCAGATTAGCGTTCGTGCCGTGAAAACTTGGCTCCTCGAGGTTAAGGATGCTCTCTATGAAGCCGACGATTTACTGGATGAAATTGCTTACGAAACTCTGCGTTCGAAACTGGTGACTGAATCTCAAAAACAACAGAAGTGGAACTTTTTCCCTTCTGCTAGTAGTAATCCACTTAAAAAGAAGGTGGAAGAAAAGTTAGAATCCGTTCTTCAAAGAATTCAGTTTCTAGCACATCTAAAGGATGCCTTGGGTCTAGTAGAATATAGTGCTGGAGAGCAATCGCCATCATTTCGGGTACCAACAACTCCTCTTGTAGATGATCAACGTATTTATGGCAGAGATGATGATAAGGAAGCCGCAATGGAGCTACTCCTATCAGATGATATAAATGACGACAATCTGGGTGTGATTTCCATAGTGGGCATGGGTGGGCTTGGTAAAACTACCCTTGCACAGCTTCTCTTCAATGACAGCAGAGCAAGCGAGCGGTTCGATCTTAGACTTTGGGTGTGCGTTTCTGAAGAATTTGATGTTCTCAAGGTGTCAAAATATATTCTCGAGTTTTTCAATTTGGAGGCTTCTGATTCTTTCAAGGGACTAAAGGAGCTTCAACAGGAGTTAATGGAGAGATTATCGGGGAAAAGATTTTTGCTTGTTCTAGATGACGTCTGGAACGAAGACCGTTATAGCTGGGAAGTATTATGGAGACCTTTAAATTGTGGGGCCAAGGGAAGCAAAATTGTGGTGACGACACGCTCCTTCAAGGTAGCATCAATCATGAGCACCGCTCCTCCTTATGTTCTAGGCCCTTTAACTGGGGACGATTGTTGGAGATTGTTTTCGCTACATGCATTTCATGGAAATTTCGATGCACATCCAGAATTAAAAGAAATTGGTAAACAAATAGTACACAAGTGCAGAGGCGTACCTTTGGCTGCAAAAGTAATTGGGGGTCTGTTGCGCTATAAAAGAAATGTTGGGGAATGGATGAATATATTGCACAGCAACGCTTGGGATTTGGCAGATGGATATGTTCTTCCATCCCTAAGGTTGCAGTATCTTCATCTACCATCACACTTAAAACAGTGTTTTACTTACTGTGCAATATTTCCCCAGGATTATGAATTCCAAATGGAGGAATTAATCCTTCTCTGGATGGCAGAAGGTTTTCTAGATCAGACTAGAGAACATGAAAAAATGGTGGTAGGTTATGGTTTTTTTAACGATCTTGTATTAAGGTCCTTTTTCCAAGAAAGCTATCGTCGATCATGTTTCATAATGCATGACTTAGTGAATGACTTAGCTCAACTTGAATCTCAAGAGTTTTGCTTCAGATTGGAGAGGAACAGGATGGATGGGGTCGTCTCTAAGAAGACTCGTCATTTATCATTTGTAATGTCCGAATCAAATACCTCTGAGATATTCGACAGAATATATGAGGAAGCTCCATTTTTGCGCACCTTTGTGTCATTAGAGCGGTTAAGTTCCAGCTCTTCTAAACACATCAATAACAAGGTATTACATGATTTAGTCTCGAAACTCCATCGCCTACGGGTACTTTCTTTGTCTGGTTATAATAGCATTGACAGATTACCTGATCCAATTGGAAATTTGATACATTTAAGATATTTGAATGTCTCTAGAATGTCAATCAGAAAGTTGCCTGATTCTGTATGTAATTTGTATAATTTGCAAACATTAATCCTGTTGTGGTGTGAATATCTCATTGAGTTGCCAGCCAAAATGGGACAGTTGATCAACTTGTGTTATCTTGAGATTGCTAGAACAAAATTGCAAGAGATGCCACCCCGGATGGGTAAACTGATGAAGCTCCAAAAGTTAACTTACTTCATTGTAGGAAGACAAAGTGAGTCTACTCTTAAAGAGTTGGCGGAGCTTCAACAGCTTCAGGGAGAGTTTTGCATTCAGAATCTTCAAAATGTTGTGGATGTTCAAGATGCTTCCAAAGCAAATTTGAAGGCTAAGAAGCAACTTAAAAAGTTGGAGTTGAGATGGGATGCGGAGACTGATGATACATTGCAGGATTTAGGCGTACTCTTACTATTACAACCTCATACCAATCTGAAATGCCTTTCCATTGTTGGTTATGGGGGTACAAGGTTTCCAAATTGGGTTGGGGACCCATCATTTGCAAATATTGTAATCTTGACACTCCGTAGGTGCAAATACTGCTCCGTTTTACCACCACTTGGGCGATTAGAGTCTCTAAAAGAACTCTCCATCATAGCATTTGATATGGTCGAGGCAGTTGGCCCTGAGTTCTATGGAAGTTCTACAGCAAGAAAAACGTCATTTGGATCCCTTGAGATTTTGAGGTTTGAAAGGATGCTAAATTGGCGGGAATGGTATTCTTATGAGCAGGCAAATGAAGGTGCAGCTTTTCCTCTCCTCCAGGAGCTTTACCTTATTGAATGTCCCAACCTAGTAAAAGCATTGCCCAGTCACCTTCCTTCTTTAAAAATACTTGGGATAGAGAGATGCCAGAAACTACTTGCTGATTCACTTCCAAGGGCTCCATCTGTTCTTCAGATGAAGTTAAAGGATGATGATAATCATCATGTGCTGCTAGAAGAATCGGAGAATGAAATCAGAAACTGGGAATTACTCAAGTCATTCTCCTCAAAGTTGTTCCCTATGGTGGAGGCTCTTCGAATCATTACATGTCCGAATCTCAATTCTGTTTCAGCATCTGAGAGACATTATGGGGATTTCACACTTCTCGATTCCATGGAGATCGGGGGGTGCCGTGATTTATTATCTTTCTCTGAAGGAGGATTAACTGCCCAAAATTTAACAAGGCTTTCATTATGGGGTTTCCCAAATTTGAAATCTCTGCCACAAAGTATGCACTCCTCCTTTCCTTCCCTTGTGGCTTTGCAAATAAGTGACTGTCCAGAACTTGAGTTGTTTCCAGCTGGGGGTTTGCCCTCCAAATTACAATCACTTGAGATTGACAGTTGCAACAAACTCATTGCGGGTCGCTTGGGATGGGATCTGCAGTTACTTCCCTCTCTTTCACACTTCAGAATTGGAATGAATGATGATGTCGAATCCTTCCCTGAGAAGACGTTATTGCCCTCTTCCCTTGCCTCTCTTGAAATCGAGCATTTTCAAAATTTGCAGTGTCTGGACTATGAGGGGCTTCAACAGCTCACCCTCCTTAAACAACTGACAATTTGCAACTGCCCCAAGCTTCAGTCCATGCCAGAAGAGGGGCTACCCAAGTCCCTTTCTTCTTTATCTATCTGCAATTGTCTTTTGCTGGAAAGAAGGTGTCAGTGGGGAAAAGGGGAAGATTGGCCTAAGATTTCCCACGTCTCCTGTGTAAAGATTAATTACCATAAAATCAACTGA


Protein sequences

Name Description Sequence
Disease resistance protein RGA2, putative Disease resistance protein RGA2, putative [Ricinus communis].

MAELAGGAFLSSFMQILFDRLTFNGAQKGALVLKSLKEIMMLINPVLLDAEEKQISVRAVKTWLLEVKDALYEADDLLDEIAYETLRSKLVTESQKQQKWNFFPSASSNPLKKKVEEKLESVLQRIQFLAHLKDALGLVEYSAGEQSPSFRVPTTPLVDDQRIYGRDDDKEAAMELLLSDDINDDNLGVISIVGMGGLGKTTLAQLLFNDSRASERFDLRLWVCVSEEFDVLKVSKYILEFFNLEASDSFKGLKELQQELMERLSGKRFLLVLDDVWNEDRYSWEVLWRPLNCGAKGSKIVVTTRSFKVASIMSTAPPYVLGPLTGDDCWRLFSLHAFHGNFDAHPELKEIGKQIVHKCRGVPLAAKVIGGLLRYKRNVGEWMNILHSNAWDLADGYVLPSLRLQYLHLPSHLKQCFTYCAIFPQDYEFQMEELILLWMAEGFLDQTREHEKMVVGYGFFNDLVLRSFFQESYRRSCFIMHDLVNDLAQLESQEFCFRLERNRMDGVVSKKTRHLSFVMSESNTSEIFDRIYEEAPFLRTFVSLERLSSSSSKHINNKVLHDLVSKLHRLRVLSLSGYNSIDRLPDPIGNLIHLRYLNVSRMSIRKLPDSVCNLYNLQTLILLWCEYLIELPAKMGQLINLCYLEIARTKLQEMPPRMGKLMKLQKLTYFIVGRQSESTLKELAELQQLQGEFCIQNLQNVVDVQDASKANLKAKKQLKKLELRWDAETDDTLQDLGVLLLLQPHTNLKCLSIVGYGGTRFPNWVGDPSFANIVILTLRRCKYCSVLPPLGRLESLKELSIIAFDMVEAVGPEFYGSSTARKTSFGSLEILRFERMLNWREWYSYEQANEGAAFPLLQELYLIECPNLVKALPSHLPSLKILGIERCQKLLADSLPRAPSVLQMKLKDDDNHHVLLEESENEIRNWELLKSFSSKLFPMVEALRIITCPNLNSVSASERHYGDFTLLDSMEIGGCRDLLSFSEGGLTAQNLTRLSLWGFPNLKSLPQSMHSSFPSLVALQISDCPELELFPAGGLPSKLQSLEIDSCNKLIAGRLGWDLQLLPSLSHFRIGMNDDVESFPEKTLLPSSLASLEIEHFQNLQCLDYEGLQQLTLLKQLTICNCPKLQSMPEEGLPKSLSSLSICNCLLLERRCQWGKGEDWPKISHVSCVKINYHKIN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF236
1-891 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

MAELAGGAFLSSFMQILFDRLTFNGAQKGALVLKSLKEIMMLINPVLLDAEEKQISVRAVKTWLLEVKDALYEADDLLDEIAYETLRSKLVTESQKQQKWNFFPSASSNPLKKKVEEKLESVLQRIQFLAHLKDALGLVEYSAGEQSPSFRVPTTPLVDDQRIYGRDDDKEAAMELLLSDDINDDNLGVISIVGMGGLGKTTLAQLLFNDSRASERFDLRLWVCVSEEFDVLKVSKYILEFFNLEASDSFKGLKELQQELMERLSGKRFLLVLDDVWNEDRYSWEVLWRPLNCGAKGSKIVVTTRSFKVASIMSTAPPYVLGPLTGDDCWRLFSLHAFHGNFDAHPELKEIGKQIVHKCRGVPLAAKVIGGLLRYKRNVGEWMNILHSNAWDLADGYVLPSLRLQYLHLPSHLKQCFTYCAIFPQDYEFQMEELILLWMAEGFLDQTREHEKMVVGYGFFNDLVLRSFFQESYRRSCFIMHDLVNDLAQLESQEFCFRLERNRMDGVVSKKTRHLSFVMSESNTSEIFDRIYEEAPFLRTFVSLERLSSSSSKHINNKVLHDLVSKLHRLRVLSLSGYNSIDRLPDPIGNLIHLRYLNVSRMSIRKLPDSVCNLYNLQTLILLWCEYLIELPAKMGQLINLCYLEIARTKLQEMPPRMGKLMKLQKLTYFIVGRQSESTLKELAELQQLQGEFCIQNLQNVVDVQDASKANLKAKKQLKKLELRWDAETDDTLQDLGVLLLLQPHTNLKCLSIVGYGGTRFPNWVGDPSFANIVILTLRRCKYCSVLPPLGRLESLKELSIIAFDMVEAVGPEFYGSSTARKTSFGSLEILRFERMLNWREWYSYEQANEGAAFPLLQELYLIECPNLVKALPSHLPSLKILGIERCQKLL

HMMPanther: PTHR23155
1-891 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MAELAGGAFLSSFMQILFDRLTFNGAQKGALVLKSLKEIMMLINPVLLDAEEKQISVRAVKTWLLEVKDALYEADDLLDEIAYETLRSKLVTESQKQQKWNFFPSASSNPLKKKVEEKLESVLQRIQFLAHLKDALGLVEYSAGEQSPSFRVPTTPLVDDQRIYGRDDDKEAAMELLLSDDINDDNLGVISIVGMGGLGKTTLAQLLFNDSRASERFDLRLWVCVSEEFDVLKVSKYILEFFNLEASDSFKGLKELQQELMERLSGKRFLLVLDDVWNEDRYSWEVLWRPLNCGAKGSKIVVTTRSFKVASIMSTAPPYVLGPLTGDDCWRLFSLHAFHGNFDAHPELKEIGKQIVHKCRGVPLAAKVIGGLLRYKRNVGEWMNILHSNAWDLADGYVLPSLRLQYLHLPSHLKQCFTYCAIFPQDYEFQMEELILLWMAEGFLDQTREHEKMVVGYGFFNDLVLRSFFQESYRRSCFIMHDLVNDLAQLESQEFCFRLERNRMDGVVSKKTRHLSFVMSESNTSEIFDRIYEEAPFLRTFVSLERLSSSSSKHINNKVLHDLVSKLHRLRVLSLSGYNSIDRLPDPIGNLIHLRYLNVSRMSIRKLPDSVCNLYNLQTLILLWCEYLIELPAKMGQLINLCYLEIARTKLQEMPPRMGKLMKLQKLTYFIVGRQSESTLKELAELQQLQGEFCIQNLQNVVDVQDASKANLKAKKQLKKLELRWDAETDDTLQDLGVLLLLQPHTNLKCLSIVGYGGTRFPNWVGDPSFANIVILTLRRCKYCSVLPPLGRLESLKELSIIAFDMVEAVGPEFYGSSTARKTSFGSLEILRFERMLNWREWYSYEQANEGAAFPLLQELYLIECPNLVKALPSHLPSLKILGIERCQKLL

superfamily: SSF52540
151-395 SSF52540

RVPTTPLVDDQRIYGRDDDKEAAMELLLSDDINDDNLGVISIVGMGGLGKTTLAQLLFNDSRASERFDLRLWVCVSEEFDVLKVSKYILEFFNLEASDSFKGLKELQQELMERLSGKRFLLVLDDVWNEDRYSWEVLWRPLNCGAKGSKIVVTTRSFKVASIMSTAPPYVLGPLTGDDCWRLFSLHAFHGNFDAHPELKEIGKQIVHKCRGVPLAAKVIGGLLRYKRNVGEWMNILHSNAWDLAD

Gene3D: G3DSA:3.40.50.300
165-308 G3DSA:3.40.50.300

GRDDDKEAAMELLLSDDINDDNLGVISIVGMGGLGKTTLAQLLFNDSRASERFDLRLWVCVSEEFDVLKVSKYILEFFNLEASDSFKGLKELQQELMERLSGKRFLLVLDDVWNEDRYSWEVLWRPLNCGAKGSKIVVTTRSFK

HMMPfam: PF00931
IPR002182
167-447 NB-ARC,NBS
NB-ARC

DDDKEAAMELLLSDDINDDNLGVISIVGMGGLGKTTLAQLLFNDSRASERFDLRLWVCVSEEFDVLKVSKYILEFFNLEASDSFKGLKELQQELMERLSGKRFLLVLDDVWNEDRYSWEVLWRPLNCGAKGSKIVVTTRSFKVASIMSTAPPYVLGPLTGDDCWRLFSLHAFHGNFDAHPELKEIGKQIVHKCRGVPLAAKVIGGLLRYKRNVGEWMNILHSNAWDLADGYVLPSLRLQYLHLPSHLKQCFTYCAIFPQDYEFQMEELILLWMAEGFLDQT

FPrintScan: PR00364
IPR000767
189-204 DISEASERSIST
Disease resistance protein

VISIVGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
263-277 DISEASERSIST
Disease resistance protein

RLSGKRFLLVLDDVW

FPrintScan: PR00364
IPR000767
359-373 DISEASERSIST
Disease resistance protein

CRGVPLAAKVIGGLL

superfamily: SSF52058
479-960 SSF52058,LRR

IMHDLVNDLAQLESQEFCFRLERNRMDGVVSKKTRHLSFVMSESNTSEIFDRIYEEAPFLRTFVSLERLSSSSSKHINNKVLHDLVSKLHRLRVLSLSGYNSIDRLPDPIGNLIHLRYLNVSRMSIRKLPDSVCNLYNLQTLILLWCEYLIELPAKMGQLINLCYLEIARTKLQEMPPRMGKLMKLQKLTYFIVGRQSESTLKELAELQQLQGEFCIQNLQNVVDVQDASKANLKAKKQLKKLELRWDAETDDTLQDLGVLLLLQPHTNLKCLSIVGYGGTRFPNWVGDPSFANIVILTLRRCKYCSVLPPLGRLESLKELSIIAFDMVEAVGPEFYGSSTARKTSFGSLEILRFERMLNWREWYSYEQANEGAAFPLLQELYLIECPNLVKALPSHLPSLKILGIERCQKLLADSLPRAPSVLQMKLKDDDNHHVLLEESENEIRNWELLKSFSSKLFPMVEALRIITCPNLNSVSASERH

Gene3D: G3DSA:3.80.10.10
542-753 G3DSA:3.80.10.10

VSLERLSSSSSKHINNKVLHDLVSKLHRLRVLSLSGYNSIDRLPDPIGNLIHLRYLNVSRMSIRKLPDSVCNLYNLQTLILLWCEYLIELPAKMGQLINLCYLEIARTKLQEMPPRMGKLMKLQKLTYFIVGRQSESTLKELAELQQLQGEFCIQNLQNVVDVQDASKANLKAKKQLKKLELRWDAETDDTLQDLGVLLLLQPHTNLKCLSI

FPrintScan: PR00364
IPR000767
874-890 DISEASERSIST
Disease resistance protein

SHLPSLKILGIERCQKL

Gene3D: G3DSA:3.80.10.10
963-1147 G3DSA:3.80.10.10

DFTLLDSMEIGGCRDLLSFSEGGLTAQNLTRLSLWGFPNLKSLPQSMHSSFPSLVALQISDCPELELFPAGGLPSKLQSLEIDSCNKLIAGRLGWDLQLLPSLSHFRIGMNDDVESFPEKTLLPSSLASLEIEHFQNLQCLDYEGLQQLTLLKQLTICNCPKLQSMPEEGLPKSLSSLSICNCLL

superfamily: SSF52058
989-1165 SSF52058,LRR

QNLTRLSLWGFPNLKSLPQSMHSSFPSLVALQISDCPELELFPAGGLPSKLQSLEIDSCNKLIAGRLGWDLQLLPSLSHFRIGMNDDVESFPEKTLLPSSLASLEIEHFQNLQCLDYEGLQQLTLLKQLTICNCPKLQSMPEEGLPKSLSSLSICNCLLLERRCQWGKGEDWPKISH






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox