PRGDB00062251 (Disease resistance protein RPM1, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RPM1, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255544064 (XM_002513049)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RPM1, putative, mRNA.

DNA Sequence

ATGGTGGTTGAAATAACCGTTTCTCTTCTGATAGGGAAACTGAATAATCTGCTTGCTGAAAGAGATATAATCTGTCCAGGATTAAGAAGCCAAGTCCGAAAGTATATTCAGGAGCTGGAACACTTACAGAGGTTTTTGAACAAAGGATCTGGTAACGAACTAGCACTAGCCTCATCCATCTCGTTGCTTCCGAGTGTTTACTCATCAGAGGATATGGTTGACAAGTTCCTCGTTAAATTATTTCGTAGAAGACGGATAAGAAATCATGTTATGAAGTTTCTCCCTTCTGCCTTGTTGTCTGCGTCGATCCAATTCTCTTTCACCAGACAGATGCAGAAATTTTTGAGCAATGATGCTACTAAATTCTCAATAATGTTTAAGATTGCTGAAGATCAACGCCAACAAAACAAGACAGAAGAAGAAGAAGAAAATGGCAGCCAGTCTCGAGAGCAACCCAAACGTTGGTCAAGAATTGCTGATTTTCTGAAGGAATCATATAATATTGTTGGTCTAGAAGATCAAAGGCATGATTTGGTTCAATTACTCCTTAGCCGCCATGGCCGCTGGTTGCCTTCCATTGTTATTGCAGTGGTTGGTGCAGCAGGCTCTGGAAAGACGACCCTAGTAAAGTTCATATACAACCGTGTACAAGAAGTTAAGCAGCATTTTGAGTGCTGTGCCTGGGTTAATGTATCTGAAGAGTTCCAAGAGCGAGATGTATTAATCAGTATATTGAGACAAATTAGTGAGGTCACAGAAGAAGAAACTCTGTCTCTGGAGGCATTGCGAATCAGAGTTAAATATTTCTTAAGCCGAAGGACTTACTTAATTGTGTTGGACGATATCCATTCGCGTGATGCTTGGGAAATACTTAAATTCGGTTTTTCAACTTCAGTAATGGGTAGCAGAGTGATTCTTACAATGCGCAGCATTGAAGTTGCACGCAGCCTTACTCCATGGATCTCACTTTTCCAGATTCGCCCTCTCAACCCACAAGAGAGTTGGCAACTCTTCCTACAAAAATTACGAAGACCAGCGAATGGTTCAGAATTGAAAAGCCTGCAGGAACTGATTGTGCGCAAATGTGCTGGATTACCTCTCGCAGTAGTTACTCTTGGTGGTCTGCTGTCTACCAAACCTTATGCTGAATGGTCAATGGTAATTGAGAGTGATACTTTTAAGTCCAGCTCCTTGAATATCTTGGCTATGAGCTATCAAGACCTACCTTCGCCAGTAAAATCTTGTCTACTTTATTCAGGATTATTTCCCAAATCACATGAAATCCCTATACGAAGATTGTTACTGTTATGGCTTGCAGAGGGACTGGCAATATCGTCTCATGGTGGAAGCATCGTCCCTGAAGATTTGGTGGAGACACACTTCGAAGAACTTGTCATAAGAAACATGATTGTGGTGGAAAAATGGAGGTTGGATGGAAGCCCGAAAACGTGCAAGGTGCAGGCTGCTCTGTATGATACCATCCTTCCTACTGCTACAGATATGGGATTCTTTCATGTTCACCGCAACTATGATTATAAAGACAAACCACCGTTTAACGTCCGGCGAATTGCTGAATATTTAGACATCAACTGCTACCCTTCAGATACTTCTCACATTGGATATTTACGGTCATACATATCTTTCAACACCCGCAAAGGAGACACACCTGCAGACCAAGTTGATAACCTTCTTAAGAAGATCTCTAAGAGAGGGTTTGGATTGCTTACTGTTCTTGATTTGGAATATGTTTATAAACCTGTGTTATCGGAGGCACTGGGAAAACTACTTCACCTAAGGTACCTAGGTCTGAGATGGACTTTTCTGGATTGGATACCTGAGTCCATTGGAAAACTACCTTGCTTGGAGACTTTAGATGTGAAGCACACAAATATTCCAGCTTTGCCTATCTCCATCTGGAAGGCAAAGAAGCTTCGGCATCTGTATATGAACGATATTCATTTCGGTATGTCTTTTCAAAAGCAAGGGATCAAGGTATCTTTAACCAACCTTCAAACGCTATGGGGGCTTTTAGTAGGAAAGAGCTGCTCAGTGATCAACTGGTTGCAGCAACTGACCAATCTGAGGAAACTGGGCTTGACTTGCCTCGACTCATCAGTTCAGAAAATAATTAATTGGATTCCTGAACTGAAAGAGAATCTAGAGTCATTGAGGTTGAGGTCAATAAACGAGTTCAATGAACCTTCAGACCTCGATTTGGGGACAATGAAGCAGCACAAGAAGCTCAGTGAATTACATTTATTTGGAAGGCTAGTGACTTTTGATATGCATGAACTCCCCCCAAATCTGACAATGCTTACTTTGTCAGTGTCACAGCTGGAACAAGATCCAATGCCAATTCTGGGGAAGTTGCCTCGCCTGAGCATCCTCAGGCTTTTTGCTAATTCATACTTGGGAAAACAAATGAGCAGTCCCCGCAATGGATTTCCTGAACTCCGAGTCCTGAAACTATGGATGCTAGAAGAGCTAGAGGAGTGGACAGTGGAGGAAGGATCCATGCGTGAACTTCAAAAATTAGAGATCAGATGCTGCACAAATCTGAAGCTGCCTGGTGGACTGTACAATCTGGCTGCTTTAGACGAGCTGACTTTAACGAATATGCCCGGAAAGTTTGTCGCAGATATTAGAACCAACACGAAGAGGAGTGTAAAAATCAGTACACATTATTGGAAATTTCCAACTTTGCCGGCAATCAAGGCTCCCTGTAGCAGCAATGCAAGAGTCTTTCTCTATGGTTGCCCGGGTATTACATTTCTGATTTCTAGTTATATTGGTATTATATTCTTATATTAA


Protein sequences

Name Description Sequence
Disease resistance protein RPM1, putative Disease resistance protein RPM1, putative [Ricinus communis].

MVVEITVSLLIGKLNNLLAERDIICPGLRSQVRKYIQELEHLQRFLNKGSGNELALASSISLLPSVYSSEDMVDKFLVKLFRRRRIRNHVMKFLPSALLSASIQFSFTRQMQKFLSNDATKFSIMFKIAEDQRQQNKTEEEEENGSQSREQPKRWSRIADFLKESYNIVGLEDQRHDLVQLLLSRHGRWLPSIVIAVVGAAGSGKTTLVKFIYNRVQEVKQHFECCAWVNVSEEFQERDVLISILRQISEVTEEETLSLEALRIRVKYFLSRRTYLIVLDDIHSRDAWEILKFGFSTSVMGSRVILTMRSIEVARSLTPWISLFQIRPLNPQESWQLFLQKLRRPANGSELKSLQELIVRKCAGLPLAVVTLGGLLSTKPYAEWSMVIESDTFKSSSLNILAMSYQDLPSPVKSCLLYSGLFPKSHEIPIRRLLLLWLAEGLAISSHGGSIVPEDLVETHFEELVIRNMIVVEKWRLDGSPKTCKVQAALYDTILPTATDMGFFHVHRNYDYKDKPPFNVRRIAEYLDINCYPSDTSHIGYLRSYISFNTRKGDTPADQVDNLLKKISKRGFGLLTVLDLEYVYKPVLSEALGKLLHLRYLGLRWTFLDWIPESIGKLPCLETLDVKHTNIPALPISIWKAKKLRHLYMNDIHFGMSFQKQGIKVSLTNLQTLWGLLVGKSCSVINWLQQLTNLRKLGLTCLDSSVQKIINWIPELKENLESLRLRSINEFNEPSDLDLGTMKQHKKLSELHLFGRLVTFDMHELPPNLTMLTLSVSQLEQDPMPILGKLPRLSILRLFANSYLGKQMSSPRNGFPELRVLKLWMLEELEEWTVEEGSMRELQKLEIRCCTNLKLPGGLYNLAALDELTLTNMPGKFVADIRTNTKRSVKISTHYWKFPTLPAIKAPCSSNARVFLYGCPGITFLISSYIGIIFLY

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
3-914 PTHR23155:SF121,SUBFAMILY NOT NAMED

VEITVSLLIGKLNNLLAERDIICPGLRSQVRKYIQELEHLQRFLNKGSGNELALASSISLLPSVYSSEDMVDKFLVKLFRRRRIRNHVMKFLPSALLSASIQFSFTRQMQKFLSNDATKFSIMFKIAEDQRQQNKTEEEEENGSQSREQPKRWSRIADFLKESYNIVGLEDQRHDLVQLLLSRHGRWLPSIVIAVVGAAGSGKTTLVKFIYNRVQEVKQHFECCAWVNVSEEFQERDVLISILRQISEVTEEETLSLEALRIRVKYFLSRRTYLIVLDDIHSRDAWEILKFGFSTSVMGSRVILTMRSIEVARSLTPWISLFQIRPLNPQESWQLFLQKLRRPANGSELKSLQELIVRKCAGLPLAVVTLGGLLSTKPYAEWSMVIESDTFKSSSLNILAMSYQDLPSPVKSCLLYSGLFPKSHEIPIRRLLLLWLAEGLAISSHGGSIVPEDLVETHFEELVIRNMIVVEKWRLDGSPKTCKVQAALYDTILPTATDMGFFHVHRNYDYKDKPPFNVRRIAEYLDINCYPSDTSHIGYLRSYISFNTRKGDTPADQVDNLLKKISKRGFGLLTVLDLEYVYKPVLSEALGKLLHLRYLGLRWTFLDWIPESIGKLPCLETLDVKHTNIPALPISIWKAKKLRHLYMNDIHFGMSFQKQGIKVSLTNLQTLWGLLVGKSCSVINWLQQLTNLRKLGLTCLDSSVQKIINWIPELKENLESLRLRSINEFNEPSDLDLGTMKQHKKLSELHLFGRLVTFDMHELPPNLTMLTLSVSQLEQDPMPILGKLPRLSILRLFANSYLGKQMSSPRNGFPELRVLKLWMLEELEEWTVEEGSMRELQKLEIRCCTNLKLPGGLYNLAALDELTLTNMPGKFVADIRTNTKRSVKISTHYWKFPTLPAIKAPCSSNARV

HMMPanther: PTHR23155
3-914 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VEITVSLLIGKLNNLLAERDIICPGLRSQVRKYIQELEHLQRFLNKGSGNELALASSISLLPSVYSSEDMVDKFLVKLFRRRRIRNHVMKFLPSALLSASIQFSFTRQMQKFLSNDATKFSIMFKIAEDQRQQNKTEEEEENGSQSREQPKRWSRIADFLKESYNIVGLEDQRHDLVQLLLSRHGRWLPSIVIAVVGAAGSGKTTLVKFIYNRVQEVKQHFECCAWVNVSEEFQERDVLISILRQISEVTEEETLSLEALRIRVKYFLSRRTYLIVLDDIHSRDAWEILKFGFSTSVMGSRVILTMRSIEVARSLTPWISLFQIRPLNPQESWQLFLQKLRRPANGSELKSLQELIVRKCAGLPLAVVTLGGLLSTKPYAEWSMVIESDTFKSSSLNILAMSYQDLPSPVKSCLLYSGLFPKSHEIPIRRLLLLWLAEGLAISSHGGSIVPEDLVETHFEELVIRNMIVVEKWRLDGSPKTCKVQAALYDTILPTATDMGFFHVHRNYDYKDKPPFNVRRIAEYLDINCYPSDTSHIGYLRSYISFNTRKGDTPADQVDNLLKKISKRGFGLLTVLDLEYVYKPVLSEALGKLLHLRYLGLRWTFLDWIPESIGKLPCLETLDVKHTNIPALPISIWKAKKLRHLYMNDIHFGMSFQKQGIKVSLTNLQTLWGLLVGKSCSVINWLQQLTNLRKLGLTCLDSSVQKIINWIPELKENLESLRLRSINEFNEPSDLDLGTMKQHKKLSELHLFGRLVTFDMHELPPNLTMLTLSVSQLEQDPMPILGKLPRLSILRLFANSYLGKQMSSPRNGFPELRVLKLWMLEELEEWTVEEGSMRELQKLEIRCCTNLKLPGGLYNLAALDELTLTNMPGKFVADIRTNTKRSVKISTHYWKFPTLPAIKAPCSSNARV

Gene3D: G3DSA:3.40.50.300
144-206 G3DSA:3.40.50.300

NGSQSREQPKRWSRIADFLKESYNIVGLEDQRHDLVQLLLSRHGRWLPSIVIAVVGAAGSGKT

superfamily: SSF52540
147-391 SSF52540

QSREQPKRWSRIADFLKESYNIVGLEDQRHDLVQLLLSRHGRWLPSIVIAVVGAAGSGKTTLVKFIYNRVQEVKQHFECCAWVNVSEEFQERDVLISILRQISEVTEEETLSLEALRIRVKYFLSRRTYLIVLDDIHSRDAWEILKFGFSTSVMGSRVILTMRSIEVARSLTPWISLFQIRPLNPQESWQLFLQKLRRPANGSELKSLQELIVRKCAGLPLAVVTLGGLLSTKPYAEWSMVIESD

HMMPfam: PF00931
IPR002182
179-447 NB-ARC,NBS
NB-ARC

VQLLLSRHGRWLPSIVIAVVGAAGSGKTTLVKFIYNRVQEVKQHFECCAWVNVSEEFQERDVLISILRQISEVTEEETLSLEALRIRVKYFLSRRTYLIVLDDIHSRDAWEILKFGFSTSVMGSRVILTMRSIEVARSLTPWISLFQIRPLNPQESWQLFLQKLRRPANGSELKSLQELIVRKCAGLPLAVVTLGGLLSTKPYAEWSMVIESDTFKSSSLNILAMSYQDLPSPVKSCLLYSGLFPKSHEIPIRRLLLLWLAEGLAISSH

HMMSmart: SM00382
IPR003593
191-332 AAA,NBS
ATPase, AAA+ type, core

PSIVIAVVGAAGSGKTTLVKFIYNRVQEVKQHFECCAWVNVSEEFQERDVLISILRQISEVTEEETLSLEALRIRVKYFLSRRTYLIVLDDIHSRDAWEILKFGFSTSVMGSRVILTMRSIEVARSLTPWISLFQIRPLNPQ

FPrintScan: PR00364
IPR000767
194-209 DISEASERSIST
Disease resistance protein

VIAVVGAAGSGKTTLV

Gene3D: G3DSA:3.40.50.300
207-284 G3DSA:3.40.50.300

TLVKFIYNRVQEVKQHFECCAWVNVSEEFQERDVLISILRQISEVTEEETLSLEALRIRVKYFLSRRTYLIVLDDIHS

FPrintScan: PR00364
IPR000767
269-283 DISEASERSIST
Disease resistance protein

FLSRRTYLIVLDDIH

FPrintScan: PR00364
IPR000767
362-376 DISEASERSIST
Disease resistance protein

CAGLPLAVVTLGGLL

superfamily: SSF52058
555-920 SSF52058,LRR

TPADQVDNLLKKISKRGFGLLTVLDLEYVYKPVLSEALGKLLHLRYLGLRWTFLDWIPESIGKLPCLETLDVKHTNIPALPISIWKAKKLRHLYMNDIHFGMSFQKQGIKVSLTNLQTLWGLLVGKSCSVINWLQQLTNLRKLGLTCLDSSVQKIINWIPELKENLESLRLRSINEFNEPSDLDLGTMKQHKKLSELHLFGRLVTFDMHELPPNLTMLTLSVSQLEQDPMPILGKLPRLSILRLFANSYLGKQMSSPRNGFPELRVLKLWMLEELEEWTVEEGSMRELQKLEIRCCTNLKLPGGLYNLAALDELTLTNMPGKFVADIRTNTKRSVKISTHYWKFPTLPAIKAPCSSNARVFLYGCP

Gene3D: G3DSA:3.80.10.10
572-753 G3DSA:3.80.10.10

FGLLTVLDLEYVYKPVLSEALGKLLHLRYLGLRWTFLDWIPESIGKLPCLETLDVKHTNIPALPISIWKAKKLRHLYMNDIHFGMSFQKQGIKVSLTNLQTLWGLLVGKSCSVINWLQQLTNLRKLGLTCLDSSVQKIINWIPELKENLESLRLRSINEFNEPSDLDLGTMKQHKKLSELHL

Gene3D: G3DSA:3.80.10.10
767-874 G3DSA:3.80.10.10

PNLTMLTLSVSQLEQDPMPILGKLPRLSILRLFANSYLGKQMSSPRNGFPELRVLKLWMLEELEEWTVEEGSMRELQKLEIRCCTNLKLPGGLYNLAALDELTLTNMP

FPrintScan: PR00364
IPR000767
837-853 DISEASERSIST
Disease resistance protein

GSMRELQKLEIRCCTNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox