PRGDB00062252 (Disease resistance protein RPM1, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RPM1, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255544062 (XM_002513048)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RPM1, putative, mRNA.

DNA Sequence

ATGGCTGATATCGTGGCGTCAATAGCTAAGGCTTTGGTACTTGACATGGGTGATAATGTTGTTGACTTCTTCAAGGGCTCAACTCTGAAGGTACTGCTCGAGAGACTGTCTGTCCAGATGAGGGCTGCCAAAGCTGTGCTTGATGATTATCAGATTACTGACGAACGTGGAAAACGGTGGCTTTACCGGCTTAGAGAAGCTAGTTATGACGCTGAAGATTTGTTGGATGAAATTGCTTATAATGCTCTGGGATCCGAGTTGGAAGCTGGCTCTCCCGAACAGGTGCGGGAATTGTTCCTTTCTCGGACGGTAGAGCAAAATTTGGAGGCTATGATTGATGAATTGGATGGTATATTAGATGACGTTGAGTTTAAAGAGACGATTACTAAGGGAGAGAATCAATCAGCAGGGGGAATGCTGACAACTTCTCGTCCAGAAGATAACGCATCGGCTATTTATGGTCGGGAGGCTGATAAGGATGCCATGATGAGTCTGCTGTTATCCGATGATCCAAGTGAAGACGATGTAGGTCTTATTCGCATTGTGGGTATGGCTGGGGTTGGTAAAACCACCTTTGCTCGCTTTCTCTACAATGACCAGAGAGTGCGATGCCATTTTGAACTTCAAGCATGGGTCTCCCTTACAAGGCTGTATGCTGTTGACAAGGTAATGCAAGTTATTATCCAGAGATTCACAGGGGATCCTTGTTATATCAGCGAATTAAGTGCGCTTCAAACTACGTTGACAGAGTTTTTAACAAAAAAAAGGTTCTTGCTTGTTTTAGATGATGAAGGTTGGAACCATGATGAAGATTGGCGCATTTTGCTCTCACCTTTGAGGTGTGGAGTAAGGGGAAGCAAGATCATTGTGACTACAAGCAATGGTGCATTATCAAACATGTGCACTGGTCCTGTTCATCATCTGAAAGAATTAACTGATGAGGATTGTTGGTCCTTGTTTTCACGATATGCATTTGATGGTGTAGATTTCAGAGCCCATCCTGACTTAGAAGAGATCGGTAGAGCAATAGCAAAAAAGTGCAAAGGCCTACCTTTGTCGGCAAAAATACTTGGGAAATTCCTGCACACCAAAAGAGATGCTTTAGAATGGAAAAACATAATGTATACAATAGCTCGGAATTTGGACGTGGGTGCCAACATTCTTCAAATTCTAAAATTGAGCTATAACTATCTCCCACCACATGTAAGGCATTGTTTAGCTTACTGCTCCATTTTCCCTAAAAATTACAGGTTTCAAAAGGAGGAACTGATTCATTTATGGATGGCAGAGGGTTTATTGGTCCAATCCGAAGGCAAAAAACATATAGAAGAAGTGGGTGAGGAGTGCTTCCAGCAAATGGTATCAAGATCATTTTTCGAGCAATCAAGTATTAATCCATCCTCCTTTGTTAAGCATGACTTGGCTACAGACGTGGCTGCAGATTCATACTTTCATGTGGATCGGGTTTATTCATATGGCAGTGCTGGAGAGGTTCGTCGTTTTCTATATGCAGAAGATGATTCCCGTGAACTGTTTGAGCTCATCCATAGACCTGAATCTTTGCGCACCTTCTTCATTATGAAGCGGTCCAATTGGATGCGGTATAATGAGGTAATAAACAAGTTATTACTGAAATTCAGGCGCTTACGAGTACTATCTCTTTCTGGATGTGATGGTATTTCTCAATTGCATGATTCAATTGGCACATTGAAGCATTTACGGTTTTTGAATATCTCAGAAACATCAATCTCAAAGTTGCCTCCATGTGTATGTAAATTATATTATTTGCAAACACTAATCTTGTACGGGTGCAAACACTTAACTGAGTTGCCAGCCAACTTGAGAAATTTAATCAACCTAAGTCTCCTTGATATCCGGGAAACAAATTTGCAATGGATGCCGTCAGCAATGGGTAAACTAACAAAGCTTCGAAAGTTGAGCGATTTCGTTGTAGGAAAACAGAAAGGATCCAGCATCAAAGAATTGGGAGTGCTTCAGCGTCTGCAAGGAGAACTCAGTGTATGGAATCTTCAAAACGTGTTGGATGCTCAAGATGCCTTTGTAGCCAATTTGAAAGAAAAGCACCTTAATGAGTTGAAGTTGAAATGGGATGAGAATACTCAAGATGCAAATCTTGAAGAAGATGTACTCAAGCAATTACAGCCTCATGTGAATGTGAAACATCTTCTTATTGCTGGTTATGGGGCAAAAAGATTTCCACAATGGGTAGGAGATTCTTCTTTCTCAAATATGGTATCCTTGAAGCTCATTGGATGCAAGTATTGCTCGTTCCTACCACCACTAGGGCAATTAAAGTCCCTTCAAGAACTTTGGATCACAGAATTCCATGGAATTGTGGATGTTGGTGCTGGCTTTTATGGAAGTTCTATTGGCATGAAGCCTTTTGGATCTCTCAAGGTTTTGAAATTTGAAAGGTTGCCATTATGGCGTGCGTGGGTTTCTTATACGGACGAAGACAACAATGAGGCTTTTCCCCTCCTACAGGAGCTCTATATACGTGATTGTCCCAGCCTTTTAAAGGCATTGCCTAGGCATCTTCCCTGTTTAACAACGCTTGACATAGAAGGATGTCAGAAACTAGTTGTGGATGTCCTTCCAAGTGCTCCTTCTATCCTAAAATATATACTGAAGGACAACTCTCGCCTTTTGCAGTTGCAGGAATTGCCTTCTGGGATGCGCCTCCTTCGAGTGGATCAATTTTTCCACTTAGATTTCATGCTAGAGAGAAAGAAGCAAGCAATCGCTCTTTCTGCTAATTTAGAAGCAATTCATATCAGTCGATGTCATTCTCTCAAGTTCTTCCCACTAGAGTATTTCCCCAACTTAAGGAGATTTGAGGTCTATGGATGTCCAAATCTTGAATCTCTTTTTGTGCTTGAAGCACTTCTTGAGGATAAGAAAGGCAATCTGTCAGAGAGTCTTTCAAATTTCCCTCTTCTCCAAGAGCTACGGATAAGAGAATGTCCAAAACTAACAAAGGCTCTACCCAGTTCCCTCCCTTCTTTAACAACTCTTGAGATAGAAGGATGTCAGCGACTAGTTGTGGCTTTTGTTCCAGAGACTTCTGCTACTTTAGAAGCAATCCATATCAGCGGATGTCATTCTCTCAAGTTCTTCCCACTAGAGTATTTCCCCAAGTTAAGGAGATTTGATGTCTATGGATGTCCAAATCTTGAATCCCTTTTTGTGCCTGAAGACGACCTATCAGGGAGTCTCTTAAATTTCCCTCTTGTTCAAGAGCTCCGCATAAGAGAATGTCCAAAACTAACAAAGGCTCTACCCAGTTCCCTCCCTTATTTAATAACACTTGAGATAGAAGGATGTCAGCAACTAGTTGTGGCGTCTGTACCAGAGGCTCCTGCCATTGTTAGGATGTTGTTAAGGATAGATACTTGTCAAATGCTGTTAGAAAAATCAACATTTGAAATTAGAAACTGGGATTCATTAAAATATTTCCCTCTAGAGATGTTTCCTAAGCTAAACACTCTTCAAATAATTTCTTGTCCAAATCTTGATTCCCTTTGTGTGTCTAAGGCACCCCTCGGGGATTTCTTATTTCTCAACTGTGTGGAAATCTGGGGATGTCATAATCTGGAATCTTTCCCTATAGGACTGGCTGCCTCGAATCTGAAAGTGCTTTCTTTAAGATGTTGCTCAAAATTGAAATCGCTGCCTGAACCAATGCCCACTCTCCTACCTTCTCTTGTGGATTTGCAAATAGTTGATTGTTCAGAACTTGATCTGCTTCCAGAAGGGGGCTGGCCCTCCAAATTAGAATCACTTGAGATCCAAAGTTGCAAAAAGCTCTTTGCTTGCCTCACGCAATGGAATTTCCAAAGTTTAACATGTCTTTCACGATTTGTATTTGGTATGTGTGAAGATGTTGAATCTTTCCCGGAGAACATGCTTTTACCTCCTAGTCTTAACTCTCTTGAAATTGGGTACTGTCAAATTTGA


Protein sequences

Name Description Sequence
Disease resistance protein RPM1, putative Disease resistance protein RPM1, putative [Ricinus communis].

MADIVASIAKALVLDMGDNVVDFFKGSTLKVLLERLSVQMRAAKAVLDDYQITDERGKRWLYRLREASYDAEDLLDEIAYNALGSELEAGSPEQVRELFLSRTVEQNLEAMIDELDGILDDVEFKETITKGENQSAGGMLTTSRPEDNASAIYGREADKDAMMSLLLSDDPSEDDVGLIRIVGMAGVGKTTFARFLYNDQRVRCHFELQAWVSLTRLYAVDKVMQVIIQRFTGDPCYISELSALQTTLTEFLTKKRFLLVLDDEGWNHDEDWRILLSPLRCGVRGSKIIVTTSNGALSNMCTGPVHHLKELTDEDCWSLFSRYAFDGVDFRAHPDLEEIGRAIAKKCKGLPLSAKILGKFLHTKRDALEWKNIMYTIARNLDVGANILQILKLSYNYLPPHVRHCLAYCSIFPKNYRFQKEELIHLWMAEGLLVQSEGKKHIEEVGEECFQQMVSRSFFEQSSINPSSFVKHDLATDVAADSYFHVDRVYSYGSAGEVRRFLYAEDDSRELFELIHRPESLRTFFIMKRSNWMRYNEVINKLLLKFRRLRVLSLSGCDGISQLHDSIGTLKHLRFLNISETSISKLPPCVCKLYYLQTLILYGCKHLTELPANLRNLINLSLLDIRETNLQWMPSAMGKLTKLRKLSDFVVGKQKGSSIKELGVLQRLQGELSVWNLQNVLDAQDAFVANLKEKHLNELKLKWDENTQDANLEEDVLKQLQPHVNVKHLLIAGYGAKRFPQWVGDSSFSNMVSLKLIGCKYCSFLPPLGQLKSLQELWITEFHGIVDVGAGFYGSSIGMKPFGSLKVLKFERLPLWRAWVSYTDEDNNEAFPLLQELYIRDCPSLLKALPRHLPCLTTLDIEGCQKLVVDVLPSAPSILKYILKDNSRLLQLQELPSGMRLLRVDQFFHLDFMLERKKQAIALSANLEAIHISRCHSLKFFPLEYFPNLRRFEVYGCPNLESLFVLEALLEDKKGNLSESLSNFPLLQELRIRECPKLTKALPSSLPSLTTLEIEGCQRLVVAFVPETSATLEAIHISGCHSLKFFPLEYFPKLRRFDVYGCPNLESLFVPEDDLSGSLLNFPLVQELRIRECPKLTKALPSSLPYLITLEIEGCQQLVVASVPEAPAIVRMLLRIDTCQMLLEKSTFEIRNWDSLKYFPLEMFPKLNTLQIISCPNLDSLCVSKAPLGDFLFLNCVEIWGCHNLESFPIGLAASNLKVLSLRCCSKLKSLPEPMPTLLPSLVDLQIVDCSELDLLPEGGWPSKLESLEIQSCKKLFACLTQWNFQSLTCLSRFVFGMCEDVESFPENMLLPPSLNSLEIGYCQI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
33-1009 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LERLSVQMRAAKAVLDDYQITDERGKRWLYRLREASYDAEDLLDEIAYNALGSELEAGSPEQVRELFLSRTVEQNLEAMIDELDGILDDVEFKETITKGENQSAGGMLTTSRPEDNASAIYGREADKDAMMSLLLSDDPSEDDVGLIRIVGMAGVGKTTFARFLYNDQRVRCHFELQAWVSLTRLYAVDKVMQVIIQRFTGDPCYISELSALQTTLTEFLTKKRFLLVLDDEGWNHDEDWRILLSPLRCGVRGSKIIVTTSNGALSNMCTGPVHHLKELTDEDCWSLFSRYAFDGVDFRAHPDLEEIGRAIAKKCKGLPLSAKILGKFLHTKRDALEWKNIMYTIARNLDVGANILQILKLSYNYLPPHVRHCLAYCSIFPKNYRFQKEELIHLWMAEGLLVQSEGKKHIEEVGEECFQQMVSRSFFEQSSINPSSFVKHDLATDVAADSYFHVDRVYSYGSAGEVRRFLYAEDDSRELFELIHRPESLRTFFIMKRSNWMRYNEVINKLLLKFRRLRVLSLSGCDGISQLHDSIGTLKHLRFLNISETSISKLPPCVCKLYYLQTLILYGCKHLTELPANLRNLINLSLLDIRETNLQWMPSAMGKLTKLRKLSDFVVGKQKGSSIKELGVLQRLQGELSVWNLQNVLDAQDAFVANLKEKHLNELKLKWDENTQDANLEEDVLKQLQPHVNVKHLLIAGYGAKRFPQWVGDSSFSNMVSLKLIGCKYCSFLPPLGQLKSLQELWITEFHGIVDVGAGFYGSSIGMKPFGSLKVLKFERLPLWRAWVSYTDEDNNEAFPLLQELYIRDCPSLLKALPRHLPCLTTLDIEGCQKLVVDVLPSAPSILKYILKDNSRLLQLQELPSGMRLLRVDQFFHLDFMLERKKQAIALSANLEAIHISRCHSLKFFPLEYFPNLRRFEVYGCPNLESLFVLEALLEDKKGNLSESLSNFPLLQELRIRECPKLTKALPSSLPSL

superfamily: SSF52540
150-381 SSF52540

SAIYGREADKDAMMSLLLSDDPSEDDVGLIRIVGMAGVGKTTFARFLYNDQRVRCHFELQAWVSLTRLYAVDKVMQVIIQRFTGDPCYISELSALQTTLTEFLTKKRFLLVLDDEGWNHDEDWRILLSPLRCGVRGSKIIVTTSNGALSNMCTGPVHHLKELTDEDCWSLFSRYAFDGVDFRAHPDLEEIGRAIAKKCKGLPLSAKILGKFLHTKRDALEWKNIMYTIARNL

HMMPfam: PF00931
IPR002182
156-436 NB-ARC,NBS
NB-ARC

EADKDAMMSLLLSDDPSEDDVGLIRIVGMAGVGKTTFARFLYNDQRVRCHFELQAWVSLTRLYAVDKVMQVIIQRFTGDPCYISELSALQTTLTEFLTKKRFLLVLDDEGWNHDEDWRILLSPLRCGVRGSKIIVTTSNGALSNMCTGPVHHLKELTDEDCWSLFSRYAFDGVDFRAHPDLEEIGRAIAKKCKGLPLSAKILGKFLHTKRDALEWKNIMYTIARNLDVGANILQILKLSYNYLPPHVRHCLAYCSIFPKNYRFQKEELIHLWMAEGLLVQS

Gene3D: G3DSA:3.40.50.300
172-295 G3DSA:3.40.50.300

SEDDVGLIRIVGMAGVGKTTFARFLYNDQRVRCHFELQAWVSLTRLYAVDKVMQVIIQRFTGDPCYISELSALQTTLTEFLTKKRFLLVLDDEGWNHDEDWRILLSPLRCGVRGSKIIVTTSNG

FPrintScan: PR00364
IPR000767
178-193 DISEASERSIST
Disease resistance protein

LIRIVGMAGVGKTTFA

FPrintScan: PR00364
IPR000767
251-265 DISEASERSIST
Disease resistance protein

FLTKKRFLLVLDDEG

FPrintScan: PR00364
IPR000767
347-361 DISEASERSIST
Disease resistance protein

CKGLPLSAKILGKFL

superfamily: SSF52058
470-958 SSF52058,LRR

VKHDLATDVAADSYFHVDRVYSYGSAGEVRRFLYAEDDSRELFELIHRPESLRTFFIMKRSNWMRYNEVINKLLLKFRRLRVLSLSGCDGISQLHDSIGTLKHLRFLNISETSISKLPPCVCKLYYLQTLILYGCKHLTELPANLRNLINLSLLDIRETNLQWMPSAMGKLTKLRKLSDFVVGKQKGSSIKELGVLQRLQGELSVWNLQNVLDAQDAFVANLKEKHLNELKLKWDENTQDANLEEDVLKQLQPHVNVKHLLIAGYGAKRFPQWVGDSSFSNMVSLKLIGCKYCSFLPPLGQLKSLQELWITEFHGIVDVGAGFYGSSIGMKPFGSLKVLKFERLPLWRAWVSYTDEDNNEAFPLLQELYIRDCPSLLKALPRHLPCLTTLDIEGCQKLVVDVLPSAPSILKYILKDNSRLLQLQELPSGMRLLRVDQFFHLDFMLERKKQAIALSANLEAIHISRCHSLKFFPLEYFPNLRRFEVYGCP

Gene3D: G3DSA:3.80.10.10
539-647 G3DSA:3.80.10.10

INKLLLKFRRLRVLSLSGCDGISQLHDSIGTLKHLRFLNISETSISKLPPCVCKLYYLQTLILYGCKHLTELPANLRNLINLSLLDIRETNLQWMPSAMGKLTKLRKLS

HMMPfam: PF13504
548-563 LRR_7,Leucine rich repeat

RLRVLSLSGCDGISQL

HMMPfam: PF00560
IPR001611
596-617 LRR_1
Leucine-rich repeat

LQTLILYGCKHLTELPANLRNL

Gene3D: G3DSA:3.80.10.10
682-880 G3DSA:3.80.10.10

DAQDAFVANLKEKHLNELKLKWDENTQDANLEEDVLKQLQPHVNVKHLLIAGYGAKRFPQWVGDSSFSNMVSLKLIGCKYCSFLPPLGQLKSLQELWITEFHGIVDVGAGFYGSSIGMKPFGSLKVLKFERLPLWRAWVSYTDEDNNEAFPLLQELYIRDCPSLLKALPRHLPCLTTLDIEGCQKLVVDVLPSAPSILK

FPrintScan: PR00364
IPR000767
851-867 DISEASERSIST
Disease resistance protein

RHLPCLTTLDIEGCQKL

Gene3D: G3DSA:3.80.10.10
925-1050 G3DSA:3.80.10.10

ANLEAIHISRCHSLKFFPLEYFPNLRRFEVYGCPNLESLFVLEALLEDKKGNLSESLSNFPLLQELRIRECPKLTKALPSSLPSLTTLEIEGCQRLVVAFVPETSATLEAIHISGCHSLKFFPLEY

superfamily: SSF52058
957-1292 SSF52058,LRR

CPNLESLFVLEALLEDKKGNLSESLSNFPLLQELRIRECPKLTKALPSSLPSLTTLEIEGCQRLVVAFVPETSATLEAIHISGCHSLKFFPLEYFPKLRRFDVYGCPNLESLFVPEDDLSGSLLNFPLVQELRIRECPKLTKALPSSLPYLITLEIEGCQQLVVASVPEAPAIVRMLLRIDTCQMLLEKSTFEIRNWDSLKYFPLEMFPKLNTLQIISCPNLDSLCVSKAPLGDFLFLNCVEIWGCHNLESFPIGLAASNLKVLSLRCCSKLKSLPEPMPTLLPSLVDLQIVDCSELDLLPEGGWPSKLESLEIQSCKKLFACLTQWNFQSLTCLS

Gene3D: G3DSA:3.80.10.10
1051-1275 G3DSA:3.80.10.10

FPKLRRFDVYGCPNLESLFVPEDDLSGSLLNFPLVQELRIRECPKLTKALPSSLPYLITLEIEGCQQLVVASVPEAPAIVRMLLRIDTCQMLLEKSTFEIRNWDSLKYFPLEMFPKLNTLQIISCPNLDSLCVSKAPLGDFLFLNCVEIWGCHNLESFPIGLAASNLKVLSLRCCSKLKSLPEPMPTLLPSLVDLQIVDCSELDLLPEGGWPSKLESLEIQSCKK

HMMPfam: PF13504
1215-1232 LRR_7,Leucine rich repeat

SNLKVLSLRCCSKLKSLP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox