PRGDB00062253 (Disease resistance protein RGA2, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RGA2, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255544018 (XM_002513026)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RGA2, putative, mRNA.

DNA Sequence

ATGTCTTCCAGCGAGGTTATAGACTTCTTGATCAAAAGCAAGAAGCTGGAGCCTGGACTGCTGCACAGAGTGAATACAACAATTATACATGTTAATGCAGTACTCTACGACGCAGAGGAGAAGCAGATCACTAATCCTGCTGTCAAAAACTGGCTCGACGACCTTCAGGATTGTGTCTTTGAAATCGATGACTTGTTGGATGAGTTTGCTCATAAAGCAGCACGATCCAAGGTGCTAAACTTTTTCTCTGCTCTTATTCCATTTAGTTATAAGGATGAGGATATGGTAGATAAGTTAGAAGAGATCCTTGAGAAGATCGATAACTTAATTAACTTAAAGGATGCTCTTAAGGGTATTGAAGGAAAGCCAATAATTCCACAAATTCCATCCACAACTTGTCTCGTAGATGAATCTGATATTTATGGCAGGGAAGCTGATCAGGAGGCCATAATGGAATTGTTGCTATCTAATGATCAAAATGACATAGTAGACGTGGTTCCCATTGTGGGTCTGTGTGGGATCGGTAAAACCACCCTTGCTCAATCTGTCTTTAACGACTATAGAGTAGATCAGGAGTTTGAAATCAGAGCATGGGTTTGTGTTGGAGGTGAATTTAATGTTTTTCAGATAACTAAAAGTTTTCTTGAAGGGATAACAGGAAAGACTTGTGACTATAAAGAATTAAACCCGCTTCAAGTTGAATTGCGGGATAGATTGAGTATGAGAAAGTTTTTGCTTGTATTAGATGATATTTGGAATGTTAATTATGAAGCCTGGGAACTTCTGCAAAAACCTTTGAAGCATGGGAGAGGAGGAGGCAAGATCATTGTTACGACACGAAATGAAAGTGTAGCATTAGTCACACTCACCATTCCAATCTATCATTTGAGAGAATTAAGTGATGATGACTGCTATACCTTGTTTAGAAGACATGCATTTGACAGTACTGAAGGAACAGGAGAGCATCCACAATTAGAAGGACTTGACCGAGAAATAGTGAGAAAGTGTAGAGGCCTACCTTTGGTTGCCAAAACATTGGGAAATCTGTTGCATTTCGAAAGAGATGCTAGAGAATGGGATAAGATATTGAGGTCCAACATATGGGATTTGCCAAGTGACAGCAGCATTCTTCAGTCTCTATTATTAAGCTACTACCAGCTCCCTTCACATCTGAAGCGGTGTTTTGCTTACTGCGCTACATTTCCAAGAAGGCATGAATTTACAAGAGCAGAAGTAGTTCGTTTATGGACCGCAAAGGAACTAATTCAGCCTAATGAAAATCGTCAGACTGAAGAACTGGGTGATGAGTACTTTCAGAACCTTGTATCAAGATCACTTTTTCAACGATCCAGTGCTAATCCGTCATCCTTTGTCATGCATGACCTCAATCATGATTTAGCTAAATTTGTCTATCGAACGTTCTTCCATCACAGAATTCGTCGCTATCCCCATCGAGGAGATACCAAGGATATTGCTGAGTGGCCCTTTATTCTCACGAACATCTTGCTAGAGATCTTGTTGCTGGCTTTTGACCAAATGGCTTCACCCAAAAAGCCACAATATGCGTTGGTTGCTGCATCCTTGTCTTTGGCAGTCTTGTTTGTTTGCATTTCTGAGCTTATTTACAAGGCAATGAAGAAAAACAGTGCTACTTTCTTTCAAATTCTGAGATGCATGCTTCATGGTTCTCTTGAGAAGAACCCATATACCTTCATTGACTGGTTTGGCCTACTCAGTGCCTTTGGTCAAGTTGTTGTCAGCAGCATAGCATACGTTTATATGCGTCAAGGTAAAGACAATCCAATTAAAGTATCCGTCGTATCCCTTAGTTTCATCATATGTTTGGCCTCTTCCAAATTAGTCAAGAATCCAAATGAGGCACAACTTCCAACTACAAGGGGCTATTAA


Protein sequences

Name Description Sequence
Disease resistance protein RGA2, putative Disease resistance protein RGA2, putative [Ricinus communis].

MSSSEVIDFLIKSKKLEPGLLHRVNTTIIHVNAVLYDAEEKQITNPAVKNWLDDLQDCVFEIDDLLDEFAHKAARSKVLNFFSALIPFSYKDEDMVDKLEEILEKIDNLINLKDALKGIEGKPIIPQIPSTTCLVDESDIYGREADQEAIMELLLSNDQNDIVDVVPIVGLCGIGKTTLAQSVFNDYRVDQEFEIRAWVCVGGEFNVFQITKSFLEGITGKTCDYKELNPLQVELRDRLSMRKFLLVLDDIWNVNYEAWELLQKPLKHGRGGGKIIVTTRNESVALVTLTIPIYHLRELSDDDCYTLFRRHAFDSTEGTGEHPQLEGLDREIVRKCRGLPLVAKTLGNLLHFERDAREWDKILRSNIWDLPSDSSILQSLLLSYYQLPSHLKRCFAYCATFPRRHEFTRAEVVRLWTAKELIQPNENRQTEELGDEYFQNLVSRSLFQRSSANPSSFVMHDLNHDLAKFVYRTFFHHRIRRYPHRGDTKDIAEWPFILTNILLEILLLAFDQMASPKKPQYALVAASLSLAVLFVCISELIYKAMKKNSATFFQILRCMLHGSLEKNPYTFIDWFGLLSAFGQVVVSSIAYVYMRQGKDNPIKVSVVSLSFIICLASSKLVKNPNEAQLPTTRGY

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF236
20-394 PTHR23155:SF236,DISEASE RESISTANCE PROTEIN (NBS-LRR CLASS)

LLHRVNTTIIHVNAVLYDAEEKQITNPAVKNWLDDLQDCVFEIDDLLDEFAHKAARSKVLNFFSALIPFSYKDEDMVDKLEEILEKIDNLINLKDALKGIEGKPIIPQIPSTTCLVDESDIYGREADQEAIMELLLSNDQNDIVDVVPIVGLCGIGKTTLAQSVFNDYRVDQEFEIRAWVCVGGEFNVFQITKSFLEGITGKTCDYKELNPLQVELRDRLSMRKFLLVLDDIWNVNYEAWELLQKPLKHGRGGGKIIVTTRNESVALVTLTIPIYHLRELSDDDCYTLFRRHAFDSTEGTGEHPQLEGLDREIVRKCRGLPLVAKTLGNLLHFERDAREWDKILRSNIWDLPSDSSILQSLLLSYYQLPSHLKRC

HMMPanther: PTHR23155
20-394 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LLHRVNTTIIHVNAVLYDAEEKQITNPAVKNWLDDLQDCVFEIDDLLDEFAHKAARSKVLNFFSALIPFSYKDEDMVDKLEEILEKIDNLINLKDALKGIEGKPIIPQIPSTTCLVDESDIYGREADQEAIMELLLSNDQNDIVDVVPIVGLCGIGKTTLAQSVFNDYRVDQEFEIRAWVCVGGEFNVFQITKSFLEGITGKTCDYKELNPLQVELRDRLSMRKFLLVLDDIWNVNYEAWELLQKPLKHGRGGGKIIVTTRNESVALVTLTIPIYHLRELSDDDCYTLFRRHAFDSTEGTGEHPQLEGLDREIVRKCRGLPLVAKTLGNLLHFERDAREWDKILRSNIWDLPSDSSILQSLLLSYYQLPSHLKRC

superfamily: SSF52540
123-373 SSF52540

PIIPQIPSTTCLVDESDIYGREADQEAIMELLLSNDQNDIVDVVPIVGLCGIGKTTLAQSVFNDYRVDQEFEIRAWVCVGGEFNVFQITKSFLEGITGKTCDYKELNPLQVELRDRLSMRKFLLVLDDIWNVNYEAWELLQKPLKHGRGGGKIIVTTRNESVALVTLTIPIYHLRELSDDDCYTLFRRHAFDSTEGTGEHPQLEGLDREIVRKCRGLPLVAKTLGNLLHFERDAREWDKILRSNIWDLPSD

Gene3D: G3DSA:3.40.50.300
142-282 G3DSA:3.40.50.300

GREADQEAIMELLLSNDQNDIVDVVPIVGLCGIGKTTLAQSVFNDYRVDQEFEIRAWVCVGGEFNVFQITKSFLEGITGKTCDYKELNPLQVELRDRLSMRKFLLVLDDIWNVNYEAWELLQKPLKHGRGGGKIIVTTRNE

HMMPfam: PF00931
IPR002182
144-425 NB-ARC,NBS
NB-ARC

EADQEAIMELLLSNDQNDIVDVVPIVGLCGIGKTTLAQSVFNDYRVDQEFEIRAWVCVGGEFNVFQITKSFLEGITGKTCDYKELNPLQVELRDRLSMRKFLLVLDDIWNVNYEAWELLQKPLKHGRGGGKIIVTTRNESVALVTLTIPIYHLRELSDDDCYTLFRRHAFDSTEGTGEHPQLEGLDREIVRKCRGLPLVAKTLGNLLHFERDAREWDKILRSNIWDLPSDSSILQSLLLSYYQLPSHLKRCFAYCATFPRRHEFTRAEVVRLWTAKELIQPN

FPrintScan: PR00364
IPR000767
165-180 DISEASERSIST
Disease resistance protein

VVPIVGLCGIGKTTLA

FPrintScan: PR00364
IPR000767
238-252 DISEASERSIST
Disease resistance protein

RLSMRKFLLVLDDIW

FPrintScan: PR00364
IPR000767
336-350 DISEASERSIST
Disease resistance protein

CRGLPLVAKTLGNLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox