PRGDB00062254 (Disease resistance protein RPP8, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RPP8, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255542200 (XM_002512118)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RPP8, putative, mRNA.

DNA Sequence

ATGGTAGATGCCGCTGTGTCTTTCTGTTTGGAAAGAATTGCTGATTTTCTCTTAGACGAAACTCAATCCCTAATCAACGTCCACGAAAATGTCGAAGAGATGAAGACTGAACTAGAATTACTGCAGGCCTTCTTGAAGGACGCAGAAGCAAAAGAAGATTATGATGAAAGAGTACGGCTATGTAATTCAATGATTAAAGATGTTGTTTGTGATGCTGAGGACTGTATCGAGACTTTTGCATTGGAGAGACAATCAACGATTGGCGGTAACATCAATCCAATATTGCGGTACAAGCTCAAATCAGATGTGGACGCACTCACTTTACGGATTTCCAAGTTGAAAAAGAACTTAGAAAATTACGGGGTAAACAATTTAGTCGGGATGGTGAAATCATCTGATCCTAATAGAAGACAGTTGCTGAAAAGTTATTCTCATATTCCCGAACTTGATGTTGTTGGATTGGAGAAAGACACTGATAATTTGGTAGAGAAATTGGTGAGCAATTCAAATGAATGCCCAGTAGTTTCCATATGCGGGATGGGCGGTTTGGGAAAAACTACACTCGCAAAACAGGTATACCATCATCTCTCAGTGAAAAACCACTTTACATTCTGCATATGGGTATATGTATCTCAAGAATGTAAGAAACGGGAAATTTGGGAAAAGATTTTATTTAAACTTACTTCTCCTGATAAAAAGAAGAGAGAGGAGATTGCGGAAATGAAAGATGAGGGGCTAGCTAAGGTGGTTTATGGCCAACTAGGATCGCAAAAGTGTTTGGTTGTACTTGACGACATCTGGGAGATTGCTGATTGGAAATGTCTTAGTCCTGCGTTCCCGCTGCAGACTACTGAAAGCATGATACTACTCACCTCTCGCAGCAAAGAACTAGCGATATCCGTACATTCTAGAGGGTTCGTCTTTGAACCACAAATTCTGGATGAGGCTGATAGCTGGAAACTGTTTCAGAAGAAAATCTCATCAGGTGATCCTCCTTTATCTACCGGATTCGATCAACAAACATTTTTGCATAAACTTTCATAA


Protein sequences

Name Description Sequence
Disease resistance protein RPP8, putative Disease resistance protein RPP8, putative [Ricinus communis].

MVDAAVSFCLERIADFLLDETQSLINVHENVEEMKTELELLQAFLKDAEAKEDYDERVRLCNSMIKDVVCDAEDCIETFALERQSTIGGNINPILRYKLKSDVDALTLRISKLKKNLENYGVNNLVGMVKSSDPNRRQLLKSYSHIPELDVVGLEKDTDNLVEKLVSNSNECPVVSICGMGGLGKTTLAKQVYHHLSVKNHFTFCIWVYVSQECKKREIWEKILFKLTSPDKKKREEIAEMKDEGLAKVVYGQLGSQKCLVVLDDIWEIADWKCLSPAFPLQTTESMILLTSRSKELAISVHSRGFVFEPQILDEADSWKLFQKKISSGDPPLSTGFDQQTFLHKLS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF233
2-272 PTHR23155:SF233,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

VDAAVSFCLERIADFLLDETQSLINVHENVEEMKTELELLQAFLKDAEAKEDYDERVRLCNSMIKDVVCDAEDCIETFALERQSTIGGNINPILRYKLKSDVDALTLRISKLKKNLENYGVNNLVGMVKSSDPNRRQLLKSYSHIPELDVVGLEKDTDNLVEKLVSNSNECPVVSICGMGGLGKTTLAKQVYHHLSVKNHFTFCIWVYVSQECKKREIWEKILFKLTSPDKKKREEIAEMKDEGLAKVVYGQLGSQKCLVVLDDIWEIADW

HMMPanther: PTHR23155
2-272 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VDAAVSFCLERIADFLLDETQSLINVHENVEEMKTELELLQAFLKDAEAKEDYDERVRLCNSMIKDVVCDAEDCIETFALERQSTIGGNINPILRYKLKSDVDALTLRISKLKKNLENYGVNNLVGMVKSSDPNRRQLLKSYSHIPELDVVGLEKDTDNLVEKLVSNSNECPVVSICGMGGLGKTTLAKQVYHHLSVKNHFTFCIWVYVSQECKKREIWEKILFKLTSPDKKKREEIAEMKDEGLAKVVYGQLGSQKCLVVLDDIWEIADW

superfamily: SSF52540
150-333 SSF52540

DVVGLEKDTDNLVEKLVSNSNECPVVSICGMGGLGKTTLAKQVYHHLSVKNHFTFCIWVYVSQECKKREIWEKILFKLTSPDKKKREEIAEMKDEGLAKVVYGQLGSQKCLVVLDDIWEIADWKCLSPAFPLQTTESMILLTSRSKELAISVHSRGFVFEPQILDEADSWKLFQKKISSGDPPL

HMMPfam: PF00931
IPR002182
155-328 NB-ARC,NBS
NB-ARC

EKDTDNLVEKLVSNSNECPVVSICGMGGLGKTTLAKQVYHHLSVKNHFTFCIWVYVSQECKKREIWEKILFKLTSPDKKKREEIAEMKDEGLAKVVYGQLGSQKCLVVLDDIWEIADWKCLSPAFPLQTTESMILLTSRSKELAISVHSRGFVFEPQILDEADSWKLFQKKISS

Gene3D: G3DSA:3.40.50.300
162-283 G3DSA:3.40.50.300

VEKLVSNSNECPVVSICGMGGLGKTTLAKQVYHHLSVKNHFTFCIWVYVSQECKKREIWEKILFKLTSPDKKKREEIAEMKDEGLAKVVYGQLGSQKCLVVLDDIWEIADWKCLSPAFPLQT

FPrintScan: PR00364
IPR000767
174-189 DISEASERSIST
Disease resistance protein

VVSICGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
253-267 DISEASERSIST
Disease resistance protein

QLGSQKCLVVLDDIW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox