PRGDB00062256 (Disease resistance protein RPP13, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RPP13, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 255538331 (XM_002510185)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Ricinus communis

Comment?

Ricinus communis Disease resistance protein RPP13, putative, mRNA.

DNA Sequence

ATGGCATTGGCGGCAGCTGTATCCATTTTGATAAAAAATCTACTAACTATCCTCGATGATAAAGAACTAAACAGTCCAAGGTTGAAGAAAGAAGTTAGCAGTGCCAAGGCTAAGTTAGAACATGTCCGAACACTCTTAACAGAGGCAGAGGCAAAGCAAAACACTAAACAAACAGTCAGTGTTGATAAATTGGAGACTAGGCTTCTAAAACGTGTTTACTCCTCAGATGACATGATTGAGTCCTTCTGTATAAGAACAGAACTGCAGAGAAGGAAGTTTTTATGTAAAGTGCGTCCTTTCACCCAATTACTGTTGCTGCAGAGCCAATCTCTTACTCGAAATATGAAGGAATTTGTGCGAGAGATTGATGTTGCATGCACTGAATGTGAAGATCAGCGAGAAGGAACTCTGGAGAATAAATTTGCCACTCAATCAAGCTTTTCAAAAGTAGATGGTGGGGATCAAGATACCACTAAATCAAGCATTACAAAGGAAGAAGCTGAGCAAATTGCTTCAAATGAAGATCATGTGCATCCCGATGGAGAAAGCAGTCCAAATGAACAACCTGCAAAAGCATATCAAGCGGATATTCAGCCTGCTAGTCGTGTTGAGCCAAGCAGCGCAGAAGTTAGACGAAGTGTTTCAGATCAAAAACTAGCGCGAAGTCCTGAGCCAAACTCACAGCAAACTGCAGCTGAACTAAGCTCACAACAGCCCGCAGCTGACCCAAGCTCACAACAGCCTGCAGCTAAACCAACCGGTGCAGAAGCTGAAGCGACAATTTCTGATGAAAAAGACAACGTCCAATACGTGAAACCAAACATTCCAAGTGAACCTGGAGCAGAAATCAATGAAACAACCATATCAGAAGAAAAGAGACCGCAGCAGTTGCCATTAATTCCAGGCTTAGATGACGATTCAGACTTTATTGGCCGAAAGGTTCAAGCAGATGAGTTAACTGAAGTAATCCGTAACCACCACAAGTTGCGTTTTCTTATTTCAGTGGTGGGTGCTGCTGGCTCTGGGAAGACAACTTTTCTGAGGAACATTTATAACAAAGCAGATATTGTGCAGAACTTTCAATTACGTGCTTGGGTTAATGTTTCTGAAGAGTTTCCAGAGACAGTCATCCCCGATGATGTTGAGCACAAGAAAAAAAATCTCTTGATTGATATACTGAGACAAGTTGCAGCAATCAAAGAGGAGGAGAAGCTGCCTCTTGACAAACTGGAGGAGAAGGTTCGTGATTTTTTTATCCGCAAGAGGTTTCTAATAGTTTTGGATGATGTCAAGACTTCTGTTATGTGGGAAAGCGTCAAGCGCACCTTTCCAAACTCATTAAATGGCAGCAGGATGATTCTCATTACTCGTGATGACAAGATAGCAGCAGAGATGAATGATCAGGGGTTCCCTCCAGTTAAGTTGCTCAATTTAGACATTGATGAAAGTTGGGCTTTGTTTTTGAAGAAAGTAGGCCAAAAAGAAGAAGGAATAACTGATGAATCCTTGAAACAGTTAATTTTCGATAAATGCAAGGGTCTACCTCTTGCAATTGTTGTGCTAGGAGGTCTCTTATCCACTAAAGATCCAGGCAGTTGGTCAAAAATGGTTGACCGCTTAAGTTTTGGTGATGATCCTTCCAAAGCTATCTTGGCGTTAGCTTATCAAGATCTTGCATCTGAGTTAAAGCCTTGTCTTCTATATTTAGGCCTTTTTCCTAAAGATCATGAGATTTCTGTTCGGAGGTTGTTCCGGTTGTGGGCTGCTGAAGGATTCGCCACTCCAACAAAAGAAGGAGAAACCCCTGAATTTCTGGTTGAGAAATATTTACAGGATTTGATCCAAAGAAACATGATAGATGTTTCAAAGTGGAGATCAGATGAAAGCCCCAAAAGGTGTCGAGTTCCTGGTATTCTCTACGATAATGTCTTTCCAAGTGCTGCAGAGATTGGATTTTTTCATGTGCTTCGTAGCCTAAACTATGATCAACAGTGCAACATCAGGAGGGTTGCTGCATATCTTGATATCAGTAATCCTGTTCTGGATCGTTGGGTTTATAATTTACGGTCTTATATATCTTTCAACACCCGAAAAGGAGATACACCTGCAGATGAAATTGACAGGTTTATCAACAAGATTATAGTGAAAAGAGGCTTTGGATTGCTCACTGTACTTGACCTAGAAAATGTCTATAAACCAGTTTTAACTGAGACAATAGGAAAACTGATCCATCTAAGGAAAAAGAGCCTTGGAGAAGATTGGTTCAACAGGCTGAAACGCCTGACGAAACTTGGACTCACATGCCATTTTGAATCACTTGGGCAGGTGACTAACTGGATTTCTAAGTCGACTCAACTTCGAGCCCTCAAGTTAAGGTCCATCGATGAATTTAGTCGACCTGCAGACCTGGAGTTAGGTACCATGAACCAGCACAAACTTCTTTCCGAATTGTATCTGCTTGGAAAGTTATCACAGGCAATTGATGACTATCTGCTTCCACAAAGTCTCAGGATGCTTACTTTATCAGTATCACAACTAAAGAATGATCCCATGCAGTACTTAGGACAGCTACCTCATCTGAAAGTTCTGAGACTTTTTGCTCGCTCTTACTTAGGGAGTGAGATGACTTGTCATGCCAAAGGGTTTCCGGAACTTCGAGTCTTGAAATTGTGGATGCTTGAGAAACTGGAGAAATGGACCGTTGAGGAAGGCTCCATGCCTTTGCTTAAGGAATTGGAGATTAGACGCTGTGAAGCACTGAAGGAAACTAGCGGTTTGCAAAACCTGACAACTCTGAAGGAACTGACCCTCACAAATATGCCCAACGACTTTGTAGCAAAGATTGAAAGCAGCATGGAGGGAATTTCAGGAAGGAAAGTGGCAGTTACTGTCAATAAATTCCATTTCGCTCCTGTGCCAAAGTAA


Protein sequences

Name Description Sequence
Disease resistance protein RPP13, putative Disease resistance protein RPP13, putative [Ricinus communis].

MALAAAVSILIKNLLTILDDKELNSPRLKKEVSSAKAKLEHVRTLLTEAEAKQNTKQTVSVDKLETRLLKRVYSSDDMIESFCIRTELQRRKFLCKVRPFTQLLLLQSQSLTRNMKEFVREIDVACTECEDQREGTLENKFATQSSFSKVDGGDQDTTKSSITKEEAEQIASNEDHVHPDGESSPNEQPAKAYQADIQPASRVEPSSAEVRRSVSDQKLARSPEPNSQQTAAELSSQQPAADPSSQQPAAKPTGAEAEATISDEKDNVQYVKPNIPSEPGAEINETTISEEKRPQQLPLIPGLDDDSDFIGRKVQADELTEVIRNHHKLRFLISVVGAAGSGKTTFLRNIYNKADIVQNFQLRAWVNVSEEFPETVIPDDVEHKKKNLLIDILRQVAAIKEEEKLPLDKLEEKVRDFFIRKRFLIVLDDVKTSVMWESVKRTFPNSLNGSRMILITRDDKIAAEMNDQGFPPVKLLNLDIDESWALFLKKVGQKEEGITDESLKQLIFDKCKGLPLAIVVLGGLLSTKDPGSWSKMVDRLSFGDDPSKAILALAYQDLASELKPCLLYLGLFPKDHEISVRRLFRLWAAEGFATPTKEGETPEFLVEKYLQDLIQRNMIDVSKWRSDESPKRCRVPGILYDNVFPSAAEIGFFHVLRSLNYDQQCNIRRVAAYLDISNPVLDRWVYNLRSYISFNTRKGDTPADEIDRFINKIIVKRGFGLLTVLDLENVYKPVLTETIGKLIHLRKKSLGEDWFNRLKRLTKLGLTCHFESLGQVTNWISKSTQLRALKLRSIDEFSRPADLELGTMNQHKLLSELYLLGKLSQAIDDYLLPQSLRMLTLSVSQLKNDPMQYLGQLPHLKVLRLFARSYLGSEMTCHAKGFPELRVLKLWMLEKLEKWTVEEGSMPLLKELEIRRCEALKETSGLQNLTTLKELTLTNMPNDFVAKIESSMEGISGRKVAVTVNKFHFAPVPK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF126
158-619 PTHR11017:SF126,OS11G0237600 PROTEIN

TKSSITKEEAEQIASNEDHVHPDGESSPNEQPAKAYQADIQPASRVEPSSAEVRRSVSDQKLARSPEPNSQQTAAELSSQQPAADPSSQQPAAKPTGAEAEATISDEKDNVQYVKPNIPSEPGAEINETTISEEKRPQQLPLIPGLDDDSDFIGRKVQADELTEVIRNHHKLRFLISVVGAAGSGKTTFLRNIYNKADIVQNFQLRAWVNVSEEFPETVIPDDVEHKKKNLLIDILRQVAAIKEEEKLPLDKLEEKVRDFFIRKRFLIVLDDVKTSVMWESVKRTFPNSLNGSRMILITRDDKIAAEMNDQGFPPVKLLNLDIDESWALFLKKVGQKEEGITDESLKQLIFDKCKGLPLAIVVLGGLLSTKDPGSWSKMVDRLSFGDDPSKAILALAYQDLASELKPCLLYLGLFPKDHEISVRRLFRLWAAEGFATPTKEGETPEFLVEKYLQDLIQRNMI

HMMPanther: PTHR11017
158-619 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TKSSITKEEAEQIASNEDHVHPDGESSPNEQPAKAYQADIQPASRVEPSSAEVRRSVSDQKLARSPEPNSQQTAAELSSQQPAADPSSQQPAAKPTGAEAEATISDEKDNVQYVKPNIPSEPGAEINETTISEEKRPQQLPLIPGLDDDSDFIGRKVQADELTEVIRNHHKLRFLISVVGAAGSGKTTFLRNIYNKADIVQNFQLRAWVNVSEEFPETVIPDDVEHKKKNLLIDILRQVAAIKEEEKLPLDKLEEKVRDFFIRKRFLIVLDDVKTSVMWESVKRTFPNSLNGSRMILITRDDKIAAEMNDQGFPPVKLLNLDIDESWALFLKKVGQKEEGITDESLKQLIFDKCKGLPLAIVVLGGLLSTKDPGSWSKMVDRLSFGDDPSKAILALAYQDLASELKPCLLYLGLFPKDHEISVRRLFRLWAAEGFATPTKEGETPEFLVEKYLQDLIQRNMI

superfamily: SSF52540
287-540 SSF52540

TISEEKRPQQLPLIPGLDDDSDFIGRKVQADELTEVIRNHHKLRFLISVVGAAGSGKTTFLRNIYNKADIVQNFQLRAWVNVSEEFPETVIPDDVEHKKKNLLIDILRQVAAIKEEEKLPLDKLEEKVRDFFIRKRFLIVLDDVKTSVMWESVKRTFPNSLNGSRMILITRDDKIAAEMNDQGFPPVKLLNLDIDESWALFLKKVGQKEEGITDESLKQLIFDKCKGLPLAIVVLGGLLSTKDPGSWSKMVDRL

Gene3D: G3DSA:3.40.50.300
306-445 G3DSA:3.40.50.300

DSDFIGRKVQADELTEVIRNHHKLRFLISVVGAAGSGKTTFLRNIYNKADIVQNFQLRAWVNVSEEFPETVIPDDVEHKKKNLLIDILRQVAAIKEEEKLPLDKLEEKVRDFFIRKRFLIVLDDVKTSVMWESVKRTFPN

HMMPfam: PF00931
IPR002182
317-596 NB-ARC,NBS
NB-ARC

DELTEVIRNHHKLRFLISVVGAAGSGKTTFLRNIYNKADIVQNFQLRAWVNVSEEFPETVIPDDVEHKKKNLLIDILRQVAAIKEEEKLPLDKLEEKVRDFFIRKRFLIVLDDVKTSVMWESVKRTFPNSLNGSRMILITRDDKIAAEMNDQGFPPVKLLNLDIDESWALFLKKVGQKEEGITDESLKQLIFDKCKGLPLAIVVLGGLLSTKDPGSWSKMVDRLSFGDDPSKAILALAYQDLASELKPCLLYLGLFPKDHEISVRRLFRLWAAEGFATPT

FPrintScan: PR00364
IPR000767
332-347 DISEASERSIST
Disease resistance protein

LISVVGAAGSGKTTFL

FPrintScan: PR00364
IPR000767
417-431 DISEASERSIST
Disease resistance protein

FFIRKRFLIVLDDVK

FPrintScan: PR00364
IPR000767
511-525 DISEASERSIST
Disease resistance protein

CKGLPLAIVVLGGLL

superfamily: SSF52058
631-942 SSF52058,LRR

KRCRVPGILYDNVFPSAAEIGFFHVLRSLNYDQQCNIRRVAAYLDISNPVLDRWVYNLRSYISFNTRKGDTPADEIDRFINKIIVKRGFGLLTVLDLENVYKPVLTETIGKLIHLRKKSLGEDWFNRLKRLTKLGLTCHFESLGQVTNWISKSTQLRALKLRSIDEFSRPADLELGTMNQHKLLSELYLLGKLSQAIDDYLLPQSLRMLTLSVSQLKNDPMQYLGQLPHLKVLRLFARSYLGSEMTCHAKGFPELRVLKLWMLEKLEKWTVEEGSMPLLKELEIRRCEALKETSGLQNLTTLKELTLTNMPN

Gene3D: G3DSA:3.80.10.10
748-954 G3DSA:3.80.10.10

KSLGEDWFNRLKRLTKLGLTCHFESLGQVTNWISKSTQLRALKLRSIDEFSRPADLELGTMNQHKLLSELYLLGKLSQAIDDYLLPQSLRMLTLSVSQLKNDPMQYLGQLPHLKVLRLFARSYLGSEMTCHAKGFPELRVLKLWMLEKLEKWTVEEGSMPLLKELEIRRCEALKETSGLQNLTTLKELTLTNMPNDFVAKIESSMEG

FPrintScan: PR00364
IPR000767
904-920 DISEASERSIST
Disease resistance protein

GSMPLLKELEIRRCEAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox