PRGDB00062257 (putative disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 238908341 (AJ550021)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Raphanus sativus

Comment?

Raphanus sativus D81Rfo (restorer-of-fertility) genomic region.

DNA Sequence

ATGATAAGAACAGAACCTGAATTTCAAAGAGAAGTGTTTAAGGAAGAAGACCTACAGCATGAACAATATCGCCAGATATGTTTCCTGTTCAGCACCACATCCCAGGAAGTCGAAATTATTGAATGTGGCGTCCAGATCGTGAGGGACAGAAGTGGCAGAAAAAGAAGCGACGCCGATGCTGTGAATATAAATCACAACAACAACTGTTGGAAGACGACGATGAAAGTCTCTACGAAAGAGATGAAGTTTCCTTCAAAAGAAGTCTCGCCTGAACAAGAAGAAAGCAGAACAAGCCAAAAGCGACAACAACAAGGATCCATAAAAAGTTCCAGTTTCAGAGACTTTCATCGATACTCTGCTCTCATGGCTTCTTCTTCCTCTTCTTCCTCGCCTCGCACATGGAGATACCGCGTCTTCACGAGCTTCCACGGACCTGACGTCCGCAAAACCTTCCTCACTCACCTACGCAAGCAGTTTAACTGCAACGGGATATCGATGTTCGACGATCAAGGGATCGAGAGAGGCCACACCATCGCCCCTGCTCTCACACAAGCGATCAGAGAATCGAGGATCTCTATCGTGGTGTTAACGAAGCACTATGCTTCTTCCAGGTGGTGTTTGGATGAGCTTTTGGGGATTCTGAAATGCAAGGAAGAGATCGGGCAGATAGTGATGACCATCTTCTACGGAGTAGATCCTTCCGATGTTCGGAAACAAACCGGAGATTTCGGGAAAGTCTTCAAGGACACATGCCGTCGTAAAACAGAGGAAGAGAGGCGAAGATGGAGCCAAGCTTTGACCGATGTGGGAAACATAGCTGGGGAACACTTTCTCAACTGGGACAAGGAATCGGAGATGATTGAAAAGATTGCGAGAGATGTCTCAAACAAGCTTAATGCTACAATCTCTAGGGATTTTGAAGACATGGTTGGTATTGAAGCACACTTGGATAAGATGCAGTCTTTGTTACATTTAGATGATGAGGATGGAGCTATGTTTGCTGGAATCTGTGGCCCTGCTGGCATTGGTAAGACTACCATTGCTAGGGCTCTACATAGTCGACTCTCTAGCAGTTTTCATCTTACTTGTTTTATGGAGAATCTTCGAGGAAGCTGTAATAGTGGTCTCGACGAGTATGGATTGAAACTGCGTTTACAAGAGCTACTTCTTTCAAAGATTTTTAACCAGAATGATATGAGGATATACCATTTAGGTGCGATACCGCAAAGAATGTGTGACCAAAAAGTTCTTATCATTCTTGATGATGTGGACGATCTGCAGCAGCTTGAGGCTCTGGCTGATGAAACTAACTGGTTTGGTGATGGAAGCAGGATTGTGGTGACCACGGAAGATCAAGAGCTTTTGGAGCAACATGGTATCAACAATACATACTATGTGGATCTTCCGACTGACGACGAGGCTCGTAAGATTTTTTGTAGATATGCTTTCAGACGGAGCTTAACACCATATGGTTTTGAAACTCTTGTCGAAAGAACAACAGAGCTTTGTGGCAAACTTCCTTTTGGTCTCCGTGTTCAATTTTACGCGGAAAGAAAGAAGACGACTGGGAAAATCGATGCAGTACTTAGAGTTGGATACGACAGTTTACATGAGAACGAACAAACTCTGTTTCTCCTCATTGCCATCTTCTTCAACTACCAAGACGATGGTCACGTGAAAACAATGCTCGCTGACACTAACTTGGATGTCAGACTCGGCTTGAAAACTCTCGCTTATAAGTCTCTCACAAAAATATCTAGCCAAGGAAAAATAGTGATGCACAAGTTACTACAACAAGTGGGCAGACAAGCAGTTCAAAGACAAGAGCCTTGGAAACGTCGGATCTTAATTGATCCTCAAGAGATCTGCGATGTTCTTGAGCCTTGGAAACGCCAAGTCCTAACTGATACCGATGAGATTCGCGATGTCCTTGAAAATGATTCTGGTAGTAGAAATTTGATGGGGGTATCTTTTGATATGTCTACAATCTTACACGACATGGATATTAGCGCAAGAGCTTTTACAAGTATGCGTAATCTTCGATTTCTCAAGGTCTACAAAACAAGATGTGATACAAATGTTAGAGTGCATTTACCCGAGGACATGGAGTTTCCACCTCGTCTGAGGTTATTACACTGGGAGGTATACCCGAGAAAGTTTCTTCCTCGTACATTTTGTACTGAACATCTTGTGGAACTCTATTTAAGAGATACCGAGCTCGAGCAATTATGGGAGGGAACCCAGCCCCTCACAAATCTCAAGAAGATGTTTTTGGGTTCGTGCCTGTATCTTAAGGAACTTCCGGATCTTGCAAAAGCTACAAACCTAGAGAAATTGAGGTTGGATCGGTGCAGGAGTTTGGTAGAGATTCATTCCTCTGTTGGAAACCTTCATAAACTAGAGAGTTTGGAAGTGGCTTTCTGTTATAATCTACAGGTTGTTCCGAATCTTTTCAACTTGGCATCTCTTGAATCATTCATGATGGTGGGATGCTACCAACTGAGGAGTCTTCCAGATATTTCTACGACCATCACAGAACTCTCAATCCCAGACACACTGTTAGAAGAGTTTACTGAACCAATTAGGCTCTGGTCTCACCTTCAGAGACTCGATATATATGGCTGTGGGGAAAATTTGGAGCAAGTGCGAAGTGACATAGCTGTTGAGAGAATTCCAGACTGCATCAAAGATCTCCAACGGTTAGAAGAACTAACTATATTTTGCTGTCCAAAACTTGTATCACTGCCAGAGCTCCCTAGGTCGCTCACATTACTAATAGTATACGAATGTGATTCACTGGAGACACTAGCACCTTTCCCTTTAGGTTCTGAGATTGAAGCTCTCTCTTTTCCCGAATGCTTCAGATTGGATCGAGAAGCAAGGAGAGTAATTACCCAGCTGCAATCATCATGGGTATGCCTACCTGGAAGAAATATACCTGCGGAGTTCCATCACCGGGTTATAGGAAATTTCTTGGCCATATGCTCAAATGCATACCGATTTAAGCTTTGTGCCGTGGTTTCCCCTAAACAGGTGATGGTGGAAGATGAAGATATAGAATTACTGTGTCACATACTCATAAATGGTTGCCCCATGAAGAGCCCCATTAAGAGCATATATAATCTTAGGATTAGAATCCAATCAGAACATCTGTTTATATTTCCCTCCACAATGCTCAAGGAAGACCGACAGCTTGGACAATACAGTGAGATATTGTTCAAATTTAGCACCACATCTCAGAACACTGAAATTATTAAATGTGGTGTCCAAATCTTGAGGGACAGAAGAAGCTGTGATTCTAAGTCAGAACAAGACGACGATGAAAGTCTCTACAGCAGCCTTGACTATGATGCACCAAGAGTAGATACCATTAACTTACTAAAGGAACATAAAGACTTGATAAGTGATTATTTCACATCATTCTTTTCCTTGTGGTGTTTGGATGAGCTTTTGGGAATTCTGAAATGCAAGGAAGAGATGGGGCAGATAGTGATGACCATCTTCTATGGAGTAGATCCTTCTGATGTTCGGAAACAAACCGGAGATTTCGGGAAAGTCTTCAAGGAAACATGCCGTCGCAAAACAGAGGAAGAGAGGCGAAGATGGAGCCAAGCTTTGACCGATGTGGGAAACATTGCCGGGGAACACTTTCTCAACTGGGACAAGGAATCGGAGATGATTGAAAAGATTGCTAGAGATGTCTCAAACAAACTTAATGCTACCATCTCTAGGGACTTTGAAGACATGGTTGGTATTGAAGCACACTTGGATGAGATGAACTCTTTGTTACATTTAGATGATGAGGATGGAGCTATGTTTGTTGGAATCTGTGGCCCTGCAGGCATTGGCAAGACTACCATTGCTAGGGCTTTACATAGCCGACTCTCCAGCACTTTCCAGCATACCTGTTTTATGGAGAACCTTAGAGGAAGCTGTAACAGTGGTACTGACGAGTATGGATTGAAGTTGCGTTTACAAGAGCTACTTCTTTCCAAGATTTTTAACCAAAATGGTGTAAAACTATTTCATTTAGGTGCCATAAAGGAAAGGTTATGCGACCTAAAAGTTCTTATCGTTCTTGATGATGTGGACGATCTGCAGCAGCTTGAGGCTTTGGCTGACGATACTAACTGGTTTGGTGATGGAAGCAGGATTATCGTAACCACGGAAGATCAAGAGATTTTGGAGCAACATGGTATCAGCAATACATACCGTGTGGATTTCCCAACTCAAGTAGATGCTCGTCAGATCTTTTGTAGATTTGCTTTTAGACAGCTCTCTGCACCCCATGGTTTTGAAAAACTTGTTGACAGAGTAATAAAGCTTTGCAGCAACCTTCCTTTGGGTCTCCGTGTCATGGGCTCGTCTTTACGCAGAAAGAAAGTAGACGACTGGGAAGGTATACTGCAGAGACTAGAGAATAGCTTTGATCAAAAGATTGATGCAGTACTTAGAGTCGGATATAACAGTTTGCATAAGGATGACCAGTTCCTGTTTCTCCTCATTGCATGCTTCTTCAACTACAAAGACGATGATCACGTGAAAGCAATGCTCGTTGATAGTAACTTGGATGTTAGACTCGGCTTGAAAAATCTCGTGTATAAATCTCTCATACAGATATCCGCAGAAGGAACCATAGTAATGCACAAGTTATTACAACAAGTGGGTAGAGAAGCGGTTCATTTGCAAGATCCTAGGAAACGCCAAATCCTAATAGATTCTCACCAGATTTGTGATGTCCTCGAAAATGATTCTGATGGTACAAGTGTGATGGGTATATCCTTTGATACATCCACAATCCCAAACGGAGTGTATATAAGCGCGCAAGGGTTTAGACGAATGCGTGATCTTCGGTTTCTCAGCATCTACGAGACAAGACGTGATCCTAATGTTAGAGTGCATTTACCTGAGGACATGAGTTTTCCACCTCTTCTAAGGTTATTACACTGGGAGGTATATCCAGGAAAGTGTCTTCCTCATACTCTTAGGCCCGAACATCTTGTGGAACTCTGTTTTGTTAACAGCATGCTCGAGCAGCTTTGGCAAGGAGTCCAGCCTCTTACAAATCTCAAGAAGATGGACTTGTCCGGGTCACTGAGTTTGAAGGAAGTCCCTGATCTTTCAAATGCTACAAGTCTCAAGAGATTAAATCTAACAGGTTGCTGGAGTTTGGTAGAGATTCCTTCCTCTATTGGAGACCTTCATAAACTGGAGGAGCTGGAGATGAATTTATGTGTAAGTGTACAGGTTTTTCCGACTCTACTCAACTTGGCATCTCTTGAATCACTCAGGATGGTAGGATGCTGGCAACTAAGCAAAATTCCTGATCTTCCAACCAACATCAAATCACTTGTAGTCGGGGAAACAATGCTACAAGAGTTTCCTGAATCAGTCAGGCTTTGGTCTCACCTTCATAGTCTCAACATATATGGCAGTGTCCTCACAGTGCCACTTTTGGAAACCACGTCGCAAGAATTCTCCCTCGCTGCTGCTACGATTGAGAGGATTCCAGATTGGATCAAAGATTTTAATGGGCTAAGGTTTCTTTACATAGCTGGCTGCACGAAACTTGGATCACTGCCAGAGCTCCCTCCCTCGCTTAGAAAACTAATAGTAGACAACTGTGAGTCACTAGAGACGGTCTGTTTTCCTTGCGACACTCCAACAACTGATTATCTCTACTTCCCCAACTGCTTCATGTTGTGCCAAGAAGCAAAGAGAGTAATCACACAGCAATCATTGAGAGCTTACTTCCCAGGAAAAGAGATGCCTGCTGCAGAGTTCGATGATCATCGATCATTTGGAAGTTCCTTGACCATCATCCGTCCGGCTATCTGCAAGTTTAGGATTTGCCTGGTGCTTTCTCCTGCACCGGATATGGAAGAAGCTTATTTCAAATTACTGTTTCGCATACGTGCAAAAGGTTGTCCCAGTGATGATGACATGCTTTCGTTAGATCTCGCTAAAATCCAAGGGGAGCATCTTTTTATATTTCACATTGAGTTTGTTGAACATCACGAGGAGATGGTGTTCAAATTCAGCACCTCATCCCACGAAGTCGACGTTATTGAATGCGGTGTACAGGTCTTGACAGATGAAACCAGCAGAAGAAGCAATGAATCTTGTTCAGAACAAGTGTCTGAAGACGGGGATGATATTCTATCGGATGATGATAAGAGCAATGAGATTTATGAACCCAGAGTAAAGATATTTACGGGTTATACAATGTTTCTTTCTTTAGTTTTTACGTTCCTTTTGAGTTTGATTTCAAGTCTAATTCTGTATAGATTCCTAAAGAACTAA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Raphanus sativus].

MIRTEPEFQREVFKEEDLQHEQYRQICFLFSTTSQEVEIIECGVQIVRDRSGRKRSDADAVNINHNNNCWKTTMKVSTKEMKFPSKEVSPEQEESRTSQKRQQQGSIKSSSFRDFHRYSALMASSSSSSSPRTWRYRVFTSFHGPDVRKTFLTHLRKQFNCNGISMFDDQGIERGHTIAPALTQAIRESRISIVVLTKHYASSRWCLDELLGILKCKEEIGQIVMTIFYGVDPSDVRKQTGDFGKVFKDTCRRKTEEERRRWSQALTDVGNIAGEHFLNWDKESEMIEKIARDVSNKLNATISRDFEDMVGIEAHLDKMQSLLHLDDEDGAMFAGICGPAGIGKTTIARALHSRLSSSFHLTCFMENLRGSCNSGLDEYGLKLRLQELLLSKIFNQNDMRIYHLGAIPQRMCDQKVLIILDDVDDLQQLEALADETNWFGDGSRIVVTTEDQELLEQHGINNTYYVDLPTDDEARKIFCRYAFRRSLTPYGFETLVERTTELCGKLPFGLRVQFYAERKKTTGKIDAVLRVGYDSLHENEQTLFLLIAIFFNYQDDGHVKTMLADTNLDVRLGLKTLAYKSLTKISSQGKIVMHKLLQQVGRQAVQRQEPWKRRILIDPQEICDVLEPWKRQVLTDTDEIRDVLENDSGSRNLMGVSFDMSTILHDMDISARAFTSMRNLRFLKVYKTRCDTNVRVHLPEDMEFPPRLRLLHWEVYPRKFLPRTFCTEHLVELYLRDTELEQLWEGTQPLTNLKKMFLGSCLYLKELPDLAKATNLEKLRLDRCRSLVEIHSSVGNLHKLESLEVAFCYNLQVVPNLFNLASLESFMMVGCYQLRSLPDISTTITELSIPDTLLEEFTEPIRLWSHLQRLDIYGCGENLEQVRSDIAVERIPDCIKDLQRLEELTIFCCPKLVSLPELPRSLTLLIVYECDSLETLAPFPLGSEIEALSFPECFRLDREARRVITQLQSSWVCLPGRNIPAEFHHRVIGNFLAICSNAYRFKLCAVVSPKQVMVEDEDIELLCHILINGCPMKSPIKSIYNLRIRIQSEHLFIFPSTMLKEDRQLGQYSEILFKFSTTSQNTEIIKCGVQILRDRRSCDSKSEQDDDESLYSSLDYDAPRVDTINLLKEHKDLISDYFTSFFSLWCLDELLGILKCKEEMGQIVMTIFYGVDPSDVRKQTGDFGKVFKETCRRKTEEERRRWSQALTDVGNIAGEHFLNWDKESEMIEKIARDVSNKLNATISRDFEDMVGIEAHLDEMNSLLHLDDEDGAMFVGICGPAGIGKTTIARALHSRLSSTFQHTCFMENLRGSCNSGTDEYGLKLRLQELLLSKIFNQNGVKLFHLGAIKERLCDLKVLIVLDDVDDLQQLEALADDTNWFGDGSRIIVTTEDQEILEQHGISNTYRVDFPTQVDARQIFCRFAFRQLSAPHGFEKLVDRVIKLCSNLPLGLRVMGSSLRRKKVDDWEGILQRLENSFDQKIDAVLRVGYNSLHKDDQFLFLLIACFFNYKDDDHVKAMLVDSNLDVRLGLKNLVYKSLIQISAEGTIVMHKLLQQVGREAVHLQDPRKRQILIDSHQICDVLENDSDGTSVMGISFDTSTIPNGVYISAQGFRRMRDLRFLSIYETRRDPNVRVHLPEDMSFPPLLRLLHWEVYPGKCLPHTLRPEHLVELCFVNSMLEQLWQGVQPLTNLKKMDLSGSLSLKEVPDLSNATSLKRLNLTGCWSLVEIPSSIGDLHKLEELEMNLCVSVQVFPTLLNLASLESLRMVGCWQLSKIPDLPTNIKSLVVGETMLQEFPESVRLWSHLHSLNIYGSVLTVPLLETTSQEFSLAAATIERIPDWIKDFNGLRFLYIAGCTKLGSLPELPPSLRKLIVDNCESLETVCFPCDTPTTDYLYFPNCFMLCQEAKRVITQQSLRAYFPGKEMPAAEFDDHRSFGSSLTIIRPAICKFRICLVLSPAPDMEEAYFKLLFRIRAKGCPSDDDMLSLDLAKIQGEHLFIFHIEFVEHHEEMVFKFSTSSHEVDVIECGVQVLTDETSRRSNESCSEQVSEDGDDILSDDDKSNEIYEPRVKIFTGYTMFLSLVFTFLLSLISSLILYRFLKN

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
124-275 TIR
Toll-Interleukin receptor

SSSSSSSPRTWRYRVFTSFHGPDVRKTFLTHLRKQFNCNGISMFDDQGIERGHTIAPALTQAIRESRISIVVLTKHYASSRWCLDELLGILKCKEEIGQIVMTIFYGVDPSDVRKQTGDFGKVFKDTCRRKTEEERRRWSQALTDVGNIAGE

Gene3D: G3DSA:3.40.50.10140
132-269 G3DSA:3.40.50.10140

RTWRYRVFTSFHGPDVRKTFLTHLRKQFNCNGISMFDDQGIERGHTIAPALTQAIRESRISIVVLTKHYASSRWCLDELLGILKCKEEIGQIVMTIFYGVDPSDVRKQTGDFGKVFKDTCRRKTEEERRRWSQALTDV

ProfileScan: PS50104
IPR000157
134-272 TIR
Toll-Interleukin receptor

WRYRVFTSFHGPDVRKTFLTHLRKQFNCNGISMFDDQGIERGHTIAPALTQAIRESRISIVVLTKHYASSRWCLDELLGILKCKEEIGQIVMTIFYGVDPSDVRKQTGDFGKVFKDTCRRKTEEERRRWSQALTDVGNI

HMMSmart: SM00255
IPR000157
135-272 TIR
Toll-Interleukin receptor

RYRVFTSFHGPDVRKTFLTHLRKQFNCNGISMFDDQGIERGHTIAPALTQAIRESRISIVVLTKHYASSRWCLDELLGILKCKEEIGQIVMTIFYGVDPSDVRKQTGDFGKVFKDTCRRKTEEERRRWSQALTDVGNI

HMMPfam: PF01582
IPR000157
138-267 TIR
Toll-Interleukin receptor

VFTSFHGPDVRKTFLTHLRKQFNCNGISMFDDQGIERGHTIAPALTQAIRESRISIVVLTKHYASSRWCLDELLGILKCKEEIGQIVMTIFYGVDPSDVRKQTGDFGKVFKDTCRRKTEEERRRWSQALT

superfamily: SSF52540
189-490 SSF52540

SRISIVVLTKHYASSRWCLDELLGILKCKEEIGQIVMTIFYGVDPSDVRKQTGDFGKVFKDTCRRKTEEERRRWSQALTDVGNIAGEHFLNWDKESEMIEKIARDVSNKLNATISRDFEDMVGIEAHLDKMQSLLHLDDEDGAMFAGICGPAGIGKTTIARALHSRLSSSFHLTCFMENLRGSCNSGLDEYGLKLRLQELLLSKIFNQNDMRIYHLGAIPQRMCDQKVLIILDDVDDLQQLEALADETNWFGDGSRIVVTTEDQELLEQHGINNTYYVDLPTDDEARKIFCRYAFRRSLTPY

Gene3D: G3DSA:3.40.50.300
282-501 G3DSA:3.40.50.300

KESEMIEKIARDVSNKLNATISRDFEDMVGIEAHLDKMQSLLHLDDEDGAMFAGICGPAGIGKTTIARALHSRLSSSFHLTCFMENLRGSCNSGLDEYGLKLRLQELLLSKIFNQNDMRIYHLGAIPQRMCDQKVLIILDDVDDLQQLEALADETNWFGDGSRIVVTTEDQELLEQHGINNTYYVDLPTDDEARKIFCRYAFRRSLTPYGFETLVERTTE

HMMPfam: PF00931
IPR002182
313-511 NB-ARC,NBS
NB-ARC

EAHLDKMQSLLHLDDEDGAMFAGICGPAGIGKTTIARALHSRLSSSFHLTCFMENLRGSCNSGLDEYGLKLRLQELLLSKIFNQNDMRIYHLGAIPQRMCDQKVLIILDDVDDLQQLEALADETNWFGDGSRIVVTTEDQELLEQHGINNTYYVDLPTDDEARKIFCRYAFRRSLTPYGFETLVERTTELCGKLPFGLR

HMMSmart: SM00382
IPR003593
330-487 AAA,NBS
ATPase, AAA+ type, core

GAMFAGICGPAGIGKTTIARALHSRLSSSFHLTCFMENLRGSCNSGLDEYGLKLRLQELLLSKIFNQNDMRIYHLGAIPQRMCDQKVLIILDDVDDLQQLEALADETNWFGDGSRIVVTTEDQELLEQHGINNTYYVDLPTDDEARKIFCRYAFRRSL

superfamily: SSF46785
523-627 SSF46785

GKIDAVLRVGYDSLHENEQTLFLLIAIFFNYQDDGHVKTMLADTNLDVRLGLKTLAYKSLTKISSQGKIVMHKLLQQVGRQAVQRQEPWKRRILIDPQEICDVLE

superfamily: SSF52058
635-940 SSF52058,LRR

TDTDEIRDVLENDSGSRNLMGVSFDMSTILHDMDISARAFTSMRNLRFLKVYKTRCDTNVRVHLPEDMEFPPRLRLLHWEVYPRKFLPRTFCTEHLVELYLRDTELEQLWEGTQPLTNLKKMFLGSCLYLKELPDLAKATNLEKLRLDRCRSLVEIHSSVGNLHKLESLEVAFCYNLQVVPNLFNLASLESFMMVGCYQLRSLPDISTTITELSIPDTLLEEFTEPIRLWSHLQRLDIYGCGENLEQVRSDIAVERIPDCIKDLQRLEELTIFCCPKLVSLPELPRSLTLLIVYECDSLETLAPFP

Gene3D: G3DSA:3.80.10.10
671-943 G3DSA:3.80.10.10

ARAFTSMRNLRFLKVYKTRCDTNVRVHLPEDMEFPPRLRLLHWEVYPRKFLPRTFCTEHLVELYLRDTELEQLWEGTQPLTNLKKMFLGSCLYLKELPDLAKATNLEKLRLDRCRSLVEIHSSVGNLHKLESLEVAFCYNLQVVPNLFNLASLESFMMVGCYQLRSLPDISTTITELSIPDTLLEEFTEPIRLWSHLQRLDIYGCGENLEQVRSDIAVERIPDCIKDLQRLEELTIFCCPKLVSLPELPRSLTLLIVYECDSLETLAPFPLGS

HMMSmart: SM00255
IPR000157
1097-1212 TIR
Toll-Interleukin receptor

SCDSKSEQDDDESLYSSLDYDAPRVDTINLLKEHKDLISDYFTSFFSLWCLDELLGILKCKEEMGQIVMTIFYGVDPSDVRKQTGDFGKVFKETCRRKTEEERRRWSQALTDVGNI

HMMPanther: PTHR11017:SF20
1099-2065 PTHR11017:SF20,SUBFAMILY NOT NAMED

DSKSEQDDDESLYSSLDYDAPRVDTINLLKEHKDLISDYFTSFFSLWCLDELLGILKCKEEMGQIVMTIFYGVDPSDVRKQTGDFGKVFKETCRRKTEEERRRWSQALTDVGNIAGEHFLNWDKESEMIEKIARDVSNKLNATISRDFEDMVGIEAHLDEMNSLLHLDDEDGAMFVGICGPAGIGKTTIARALHSRLSSTFQHTCFMENLRGSCNSGTDEYGLKLRLQELLLSKIFNQNGVKLFHLGAIKERLCDLKVLIVLDDVDDLQQLEALADDTNWFGDGSRIIVTTEDQEILEQHGISNTYRVDFPTQVDARQIFCRFAFRQLSAPHGFEKLVDRVIKLCSNLPLGLRVMGSSLRRKKVDDWEGILQRLENSFDQKIDAVLRVGYNSLHKDDQFLFLLIACFFNYKDDDHVKAMLVDSNLDVRLGLKNLVYKSLIQISAEGTIVMHKLLQQVGREAVHLQDPRKRQILIDSHQICDVLENDSDGTSVMGISFDTSTIPNGVYISAQGFRRMRDLRFLSIYETRRDPNVRVHLPEDMSFPPLLRLLHWEVYPGKCLPHTLRPEHLVELCFVNSMLEQLWQGVQPLTNLKKMDLSGSLSLKEVPDLSNATSLKRLNLTGCWSLVEIPSSIGDLHKLEELEMNLCVSVQVFPTLLNLASLESLRMVGCWQLSKIPDLPTNIKSLVVGETMLQEFPESVRLWSHLHSLNIYGSVLTVPLLETTSQEFSLAAATIERIPDWIKDFNGLRFLYIAGCTKLGSLPELPPSLRKLIVDNCESLETVCFPCDTPTTDYLYFPNCFMLCQEAKRVITQQSLRAYFPGKEMPAAEFDDHRSFGSSLTIIRPAICKFRICLVLSPAPDMEEAYFKLLFRIRAKGCPSDDDMLSLDLAKIQGEHLFIFHIEFVEHHEEMVFKFSTSSHEVDVIECGVQVLTDETSRRSNESCSEQVSEDGDDILSDDDKSNEIYE

HMMPanther: PTHR11017
1099-2065 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DSKSEQDDDESLYSSLDYDAPRVDTINLLKEHKDLISDYFTSFFSLWCLDELLGILKCKEEMGQIVMTIFYGVDPSDVRKQTGDFGKVFKETCRRKTEEERRRWSQALTDVGNIAGEHFLNWDKESEMIEKIARDVSNKLNATISRDFEDMVGIEAHLDEMNSLLHLDDEDGAMFVGICGPAGIGKTTIARALHSRLSSTFQHTCFMENLRGSCNSGTDEYGLKLRLQELLLSKIFNQNGVKLFHLGAIKERLCDLKVLIVLDDVDDLQQLEALADDTNWFGDGSRIIVTTEDQEILEQHGISNTYRVDFPTQVDARQIFCRFAFRQLSAPHGFEKLVDRVIKLCSNLPLGLRVMGSSLRRKKVDDWEGILQRLENSFDQKIDAVLRVGYNSLHKDDQFLFLLIACFFNYKDDDHVKAMLVDSNLDVRLGLKNLVYKSLIQISAEGTIVMHKLLQQVGREAVHLQDPRKRQILIDSHQICDVLENDSDGTSVMGISFDTSTIPNGVYISAQGFRRMRDLRFLSIYETRRDPNVRVHLPEDMSFPPLLRLLHWEVYPGKCLPHTLRPEHLVELCFVNSMLEQLWQGVQPLTNLKKMDLSGSLSLKEVPDLSNATSLKRLNLTGCWSLVEIPSSIGDLHKLEELEMNLCVSVQVFPTLLNLASLESLRMVGCWQLSKIPDLPTNIKSLVVGETMLQEFPESVRLWSHLHSLNIYGSVLTVPLLETTSQEFSLAAATIERIPDWIKDFNGLRFLYIAGCTKLGSLPELPPSLRKLIVDNCESLETVCFPCDTPTTDYLYFPNCFMLCQEAKRVITQQSLRAYFPGKEMPAAEFDDHRSFGSSLTIIRPAICKFRICLVLSPAPDMEEAYFKLLFRIRAKGCPSDDDMLSLDLAKIQGEHLFIFHIEFVEHHEEMVFKFSTSSHEVDVIECGVQVLTDETSRRSNESCSEQVSEDGDDILSDDDKSNEIYE

ProfileScan: PS50104
IPR000157
1133-1212 TIR
Toll-Interleukin receptor

LISDYFTSFFSLWCLDELLGILKCKEEMGQIVMTIFYGVDPSDVRKQTGDFGKVFKETCRRKTEEERRRWSQALTDVGNI

HMMPfam: PF01582
IPR000157
1142-1207 TIR
Toll-Interleukin receptor

FSLWCLDELLGILKCKEEMGQIVMTIFYGVDPSDVRKQTGDFGKVFKETCRRKTEEERRRWSQALT

Gene3D: G3DSA:3.40.50.10140
1143-1209 G3DSA:3.40.50.10140

SLWCLDELLGILKCKEEMGQIVMTIFYGVDPSDVRKQTGDFGKVFKETCRRKTEEERRRWSQALTDV

superfamily: SSF52200
IPR000157
1143-1215 TIR
Toll-Interleukin receptor

SLWCLDELLGILKCKEEMGQIVMTIFYGVDPSDVRKQTGDFGKVFKETCRRKTEEERRRWSQALTDVGNIAGE

superfamily: SSF52540
1232-1480 SSF52540

RDVSNKLNATISRDFEDMVGIEAHLDEMNSLLHLDDEDGAMFVGICGPAGIGKTTIARALHSRLSSTFQHTCFMENLRGSCNSGTDEYGLKLRLQELLLSKIFNQNGVKLFHLGAIKERLCDLKVLIVLDDVDDLQQLEALADDTNWFGDGSRIIVTTEDQEILEQHGISNTYRVDFPTQVDARQIFCRFAFRQLSAPHGFEKLVDRVIKLCSNLPLGLRVMGSSLRRKKVDDWEGILQRLENSFDQKI

Gene3D: G3DSA:3.40.50.300
1247-1285 G3DSA:3.40.50.300

EDMVGIEAHLDEMNSLLHLDDEDGAMFVGICGPAGIGKT

HMMPfam: PF00931
IPR002182
1254-1510 NB-ARC,NBS
NB-ARC

AHLDEMNSLLHLDDEDGAMFVGICGPAGIGKTTIARALHSRLSSTFQHTCFMENLRGSCNSGTDEYGLKLRLQELLLSKIFNQNGVKLFHLGAIKERLCDLKVLIVLDDVDDLQQLEALADDTNWFGDGSRIIVTTEDQEILEQHGISNTYRVDFPTQVDARQIFCRFAFRQLSAPHGFEKLVDRVIKLCSNLPLGLRVMGSSLRRKKVDDWEGILQRLENSFDQKIDAVLRVGYNSLHKDDQFLFLLIACFFNYKD

HMMSmart: SM00382
IPR003593
1270-1418 AAA,NBS
ATPase, AAA+ type, core

GAMFVGICGPAGIGKTTIARALHSRLSSTFQHTCFMENLRGSCNSGTDEYGLKLRLQELLLSKIFNQNGVKLFHLGAIKERLCDLKVLIVLDDVDDLQQLEALADDTNWFGDGSRIIVTTEDQEILEQHGISNTYRVDFPTQVDARQIF

FPrintScan: PR00364
IPR000767
1273-1288 DISEASERSIST
Disease resistance protein

FVGICGPAGIGKTTIA

Gene3D: G3DSA:3.40.50.300
1286-1311 G3DSA:3.40.50.300

TIARALHSRLSSTFQHTCFMENLRGS

FPrintScan: PR00364
IPR000767
1350-1364 DISEASERSIST
Disease resistance protein

RLCDLKVLIVLDDVD

Gene3D: G3DSA:3.40.50.300
1355-1445 G3DSA:3.40.50.300

KVLIVLDDVDDLQQLEALADDTNWFGDGSRIIVTTEDQEILEQHGISNTYRVDFPTQVDARQIFCRFAFRQLSAPHGFEKLVDRVIKLCSN

FPrintScan: PR00364
IPR000767
1443-1457 DISEASERSIST
Disease resistance protein

CSNLPLGLRVMGSSL

superfamily: SSF46785
1478-1582 SSF46785

QKIDAVLRVGYNSLHKDDQFLFLLIACFFNYKDDDHVKAMLVDSNLDVRLGLKNLVYKSLIQISAEGTIVMHKLLQQVGREAVHLQDPRKRQILIDSHQICDVLE

superfamily: SSF52058
1553-1903 SSF52058,LRR

QQVGREAVHLQDPRKRQILIDSHQICDVLENDSDGTSVMGISFDTSTIPNGVYISAQGFRRMRDLRFLSIYETRRDPNVRVHLPEDMSFPPLLRLLHWEVYPGKCLPHTLRPEHLVELCFVNSMLEQLWQGVQPLTNLKKMDLSGSLSLKEVPDLSNATSLKRLNLTGCWSLVEIPSSIGDLHKLEELEMNLCVSVQVFPTLLNLASLESLRMVGCWQLSKIPDLPTNIKSLVVGETMLQEFPESVRLWSHLHSLNIYGSVLTVPLLETTSQEFSLAAATIERIPDWIKDFNGLRFLYIAGCTKLGSLPELPPSLRKLIVDNCESLETVCFPCDTPTTDYLYFPNCFMLCQ

Gene3D: G3DSA:3.80.10.10
1606-1876 G3DSA:3.80.10.10

ISAQGFRRMRDLRFLSIYETRRDPNVRVHLPEDMSFPPLLRLLHWEVYPGKCLPHTLRPEHLVELCFVNSMLEQLWQGVQPLTNLKKMDLSGSLSLKEVPDLSNATSLKRLNLTGCWSLVEIPSSIGDLHKLEELEMNLCVSVQVFPTLLNLASLESLRMVGCWQLSKIPDLPTNIKSLVVGETMLQEFPESVRLWSHLHSLNIYGSVLTVPLLETTSQEFSLAAATIERIPDWIKDFNGLRFLYIAGCTKLGSLPELPPSLRKLIVDNCE

FPrintScan: PR00364
IPR000767
1685-1701 DISEASERSIST
Disease resistance protein

QPLTNLKKMDLSGSLSL

HMMPfam: PF00560
IPR001611
1712-1733 LRR_1
Leucine-rich repeat

SLKRLNLTGCWSLVEIPSSIGD


List of References

Sophie Desloire, Hassen Gherbi, Wassila Laloui, Sylvie Marhadour, Vanessa Clouet, Laurence Cattolico, Cyril Falentin, Sandra Giancola, Michel Renard, Françoise Budar, Ian Small, Michel Caboche, Régine Delourme, Abdelhafid Bendahmane
Identification of the fertility restoration locus, Rfo, in radish, as a member of the pentatricopeptide-repeat protein family.
EMBO Rep.: 2003, 4(6);588-94
PubMed:12740605 WorldCat.org DOI (P p)

M Uyttewaal, N Arnal, M Quadrado, A Martin-Canadell, N Vrielynck, S Hiard, H Gherbi, A Bendahmane, F Budar, H Mireau
Characterization of Raphanus sativus pentatricopeptide repeat proteins encoded by the fertility restorer locus for Ogura cytoplasmic male sterility.
Plant Cell: 2008, 20(12);3331-45
PubMed:19098270 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox