PRGDB00062263 (verticillium wilt disease resistance protein)

From PRG Wiki
Jump to: navigation, search
verticillium wilt disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 237899602 (FJ464557)
Gene Class Unknown
Domain Type LRR
Gene Species Solanum lycopersicum

Comment?

Solanum lycopersicum cultivar VFN-8 verticillium wilt disease resistance protein (Ve1) gene, complete cds.

DNA Sequence

ATGAAAATGATGGCAACTCTGTACTTCCTATGGCTTCTCTTGATTCCCTCGTTTCAAATCTTATCAGGATACCACATTTTCTTGGTTTCCTCTCAATGCCTTGACGATCAAAAGTCATTGTTGCTGCAGTTTAAGGGAAGCCTCCAATATGATTCTACTTTGTCAAAGAAATTGGCAAAATGGAACGACATGACAAGTGAATGTTGCAATTGGAATGGGGTTACATGCAATCTCTTTGGTCATGTGATCGCTTTGGAACTGGATGATGAGACTATTTCTAGTGGAATTGAGAATTCTAGTGCACTTTTCAGTCTTCAATATCTTGAGAGCCTAAATTTGGCTGACAACATGTTCAATGTTGGCATACCAGTTGGTATAGCCAACCTCACAAACTTGAAGTACCTGAATTTATCCAATGCTGGTTTTGTCGGGCAAATTCCTATAACATTATCAAGATTAACAAGGCTAGTTACTCTTGATCTCTCAACTATTCTCCCTTTTTTTGATCAGCCACTTAAACTTGAGAATCCCAATTTGAGTCATTTCATTGAGAACTCAACAGAGCTTAGAGAGCTTTACCTTGATGGGGTTGATCTTTCGTCTCAGAGGACTGAGTGGTGTCAATCTTTATCTTTACATTTGCCTAACTTGACCGTTTTGAGCTTGCGTGATTGTCAAATTTCAGGCCCTTTGGATGAATCACTTTCTAAGCTTCACTTTCTCTCTTTTGTCCAACTTGACCAGAACAATCTCTCTAGCACAGTTCCTGAATATTTTGCCAATTTCTCGAACTTGACTACATTGACCCTGGGCTCTTGTAATCTACAGGGAACATTTCCTGAAAGAATCTTTCAGGTATCAGTTTTAGAGAGTTTGGACTTGTCAATTAACAAGTTGCTTCGTGGTAGTATTCCAATTTTTTTCCGAAATGGATCTCTGAGGAGGATATCACTAAGCTACACCAACTTTTCCGGTTCATTACCAGAGTCCATTTCGAACCATCAAAATCTATCCAGGTTAGAGCTTTCTAATTGCAATTTCTATGGATCAATACCTTCCACAATGGCAAACCTTAGAAATCTTGGTTATTTGGATTTCTCCTTCAACAATTTCACTGGTTCTATCCCATATTTTCGACTGTCCAAGAAACTCACCTACTTAGACCTTTCACGTAATGGTCTAACTGGTCTCTTGTCTAGAGCTCATTTTGAAGGACTCTCAGAGCTTGTCCACATTAATTTAGGGAACAATTTACTCAGCGGGAGCCTTCCTGCATATATATTTGAGCTCCCCTCGTTGCAGCAGCTTTTTCTTTACAGAAATCAATTTGTTGGCCAAGTCGACGAATTTCGCAATGCATCCTCCTCTCCGTTGGATACAGTTGACTTGACAAACAACCACCTGAATGGATCGATTCCGAAGTCCATGTTTGAAATTGAAAGGCTTAAGGTGCTCTCACTTTCTTCCAACTTCTTTAGAGGGACAGTGCCCCTTGACCTCATTGGGAGGCTGAGCAACCTTTCAAGACTGGAGCTTTCTTACAATAACTTGACTGTTGATGCAAGTAGCAGCAATTCAACCTCTTTCACATTTCCCCAGTTGAACATATTGAAATTAGCGTCTTGTCGGCTGCAAAAGTTCCCCGATCTCAAGAATCAGTCATGGATGATGCACTTAGACCTTTCAGACAACCAAATATTGGGGGCAATACCAAATTGGATCTGGGGAATTGGTGGTGGAGGTCTCACCCACCTGAATCTTTCATTCAATCAGCTGGAGTACGTGGAACAGCCTTACACTGCTTCCAGCAATCTTGTAGTCCTTGATTTGCATTCCAACCGTTTAAAAGGTGACTTACTAATACCACCTTGCACTGCCATCTATGTGGACTACTCTAGCAATAATTTAAACAATTCCATCCCAACAGATATTGGAAAGTCTCTTGGTTTTGCCTCCTTTTTCTCGGTAGCAAACAATGGCATTACTGGAATAATTCCTGAATCCATATGCAACTGCAGCTACCTTCAAGTTCTTGATTTCTCTAACAATGCCTTGAGTGGAACAATACCACCATGTCTACTGGAATATAGTACAAAACTTGGAGTGCTGAATCTTGGGAACAATAAACTCAATGGTGTTATACCAGATTCATTTTCAATTGGTTGTGCTCTACAAACATTAGACCTCAGTGCGAATAACTTACAAGGCAGGCTGCCAAAATCGATTGTGAATTGTAAGTTGTTGGAGGTCCTGAATGTTGGAAATAACAGACTTGTTGATCATTTCCCATGCATGTTGAGGAACTCAAACAGTCTGAGGGTCCTAGTCTTGCGCTCCAATAAATTCTATGGAAATCTTATGTGTGATGTAACCAGAAATAGCTGGCAGAATCTCCAGATCATAGATATAGCTTCCAACAACTTCACTGGTGTGTTGAATGCAGAATTCTTTTCAAATTGGAGAGGAATGATGGTTGCAGATGATTACGTGGAGACAGGACGCAATCATATCCAGTATGAGTTCTTACAACTAAGTAAATTGTACTATCAGGACACAGTGACATTAACCATCAAAGGCATGGAGCTGGAGCTTGTGAAGATTCTCAGGGTCTTCACATCTATTGATTTCTCTTCCAATAGATTTCAAGGAGCGATACCAGATGCTATCGGGAATCTCAGCTCACTTTATGTTCTGAATCTGTCACACAATGCCCTTGAGGGACCAATCCCAAAATCGATTGGGAAGCTACAAATGCTTGAATCACTAGACCTGTCAACAAACCACCTGTCCGGGGAGATCCCATCAGAGCTTGCAAGTCTCACATTCTTAGCAGCTTTGAACTTATCGTTCAACAAATTGTTTGGCAAAATTCCATCAACTAATCAGTTTCAAACATTCTCAGCAGATTCCTTTGAAGGAAACAGTGGCCTATGCGGGCTCCCTCTCAACAACAGTTGTCAAAGCAATGGCTCAGCCTCAGAGTCCCTGCCTCCACCAACTCCGCTACCAGACTCAGATGATGAATGGGAGTTCATTTTTGCAGCAGTTGGATACATAGTAGGGGCAGCAAATACTATTTCAGTTGTGTGGTTTTACAAGCCAGTGAAGAAATGGTTTGATAAGCATATGGAGAAATGCTTGCTTTGGTTTTCAAGAAAGTGA


Protein sequences

Name Description Sequence
verticillium wilt disease resistance protein verticillium wilt disease resistance protein [Solanum lycopersicum].

MKMMATLYFLWLLLIPSFQILSGYHIFLVSSQCLDDQKSLLLQFKGSLQYDSTLSKKLAKWNDMTSECCNWNGVTCNLFGHVIALELDDETISSGIENSSALFSLQYLESLNLADNMFNVGIPVGIANLTNLKYLNLSNAGFVGQIPITLSRLTRLVTLDLSTILPFFDQPLKLENPNLSHFIENSTELRELYLDGVDLSSQRTEWCQSLSLHLPNLTVLSLRDCQISGPLDESLSKLHFLSFVQLDQNNLSSTVPEYFANFSNLTTLTLGSCNLQGTFPERIFQVSVLESLDLSINKLLRGSIPIFFRNGSLRRISLSYTNFSGSLPESISNHQNLSRLELSNCNFYGSIPSTMANLRNLGYLDFSFNNFTGSIPYFRLSKKLTYLDLSRNGLTGLLSRAHFEGLSELVHINLGNNLLSGSLPAYIFELPSLQQLFLYRNQFVGQVDEFRNASSSPLDTVDLTNNHLNGSIPKSMFEIERLKVLSLSSNFFRGTVPLDLIGRLSNLSRLELSYNNLTVDASSSNSTSFTFPQLNILKLASCRLQKFPDLKNQSWMMHLDLSDNQILGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLKGDLLIPPCTAIYVDYSSNNLNNSIPTDIGKSLGFASFFSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNRLVDHFPCMLRNSNSLRVLVLRSNKFYGNLMCDVTRNSWQNLQIIDIASNNFTGVLNAEFFSNWRGMMVADDYVETGRNHIQYEFLQLSKLYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGAIPDAIGNLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALNLSFNKLFGKIPSTNQFQTFSADSFEGNSGLCGLPLNNSCQSNGSASESLPPPTPLPDSDDEWEFIFAAVGYIVGAANTISVVWFYKPVKKWFDKHMEKCLLWFSRK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
1-986 PTHR24420:SF473,SUBFAMILY NOT NAMED

MKMMATLYFLWLLLIPSFQILSGYHIFLVSSQCLDDQKSLLLQFKGSLQYDSTLSKKLAKWNDMTSECCNWNGVTCNLFGHVIALELDDETISSGIENSSALFSLQYLESLNLADNMFNVGIPVGIANLTNLKYLNLSNAGFVGQIPITLSRLTRLVTLDLSTILPFFDQPLKLENPNLSHFIENSTELRELYLDGVDLSSQRTEWCQSLSLHLPNLTVLSLRDCQISGPLDESLSKLHFLSFVQLDQNNLSSTVPEYFANFSNLTTLTLGSCNLQGTFPERIFQVSVLESLDLSINKLLRGSIPIFFRNGSLRRISLSYTNFSGSLPESISNHQNLSRLELSNCNFYGSIPSTMANLRNLGYLDFSFNNFTGSIPYFRLSKKLTYLDLSRNGLTGLLSRAHFEGLSELVHINLGNNLLSGSLPAYIFELPSLQQLFLYRNQFVGQVDEFRNASSSPLDTVDLTNNHLNGSIPKSMFEIERLKVLSLSSNFFRGTVPLDLIGRLSNLSRLELSYNNLTVDASSSNSTSFTFPQLNILKLASCRLQKFPDLKNQSWMMHLDLSDNQILGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLKGDLLIPPCTAIYVDYSSNNLNNSIPTDIGKSLGFASFFSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNRLVDHFPCMLRNSNSLRVLVLRSNKFYGNLMCDVTRNSWQNLQIIDIASNNFTGVLNAEFFSNWRGMMVADDYVETGRNHIQYEFLQLSKLYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGAIPDAIGNLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALNLSFNKLFGKIPSTNQFQTFSADSFEGNSGLCGLPLNNSC

HMMPanther: PTHR24420
1-986 PTHR24420,FAMILY NOT NAMED

MKMMATLYFLWLLLIPSFQILSGYHIFLVSSQCLDDQKSLLLQFKGSLQYDSTLSKKLAKWNDMTSECCNWNGVTCNLFGHVIALELDDETISSGIENSSALFSLQYLESLNLADNMFNVGIPVGIANLTNLKYLNLSNAGFVGQIPITLSRLTRLVTLDLSTILPFFDQPLKLENPNLSHFIENSTELRELYLDGVDLSSQRTEWCQSLSLHLPNLTVLSLRDCQISGPLDESLSKLHFLSFVQLDQNNLSSTVPEYFANFSNLTTLTLGSCNLQGTFPERIFQVSVLESLDLSINKLLRGSIPIFFRNGSLRRISLSYTNFSGSLPESISNHQNLSRLELSNCNFYGSIPSTMANLRNLGYLDFSFNNFTGSIPYFRLSKKLTYLDLSRNGLTGLLSRAHFEGLSELVHINLGNNLLSGSLPAYIFELPSLQQLFLYRNQFVGQVDEFRNASSSPLDTVDLTNNHLNGSIPKSMFEIERLKVLSLSSNFFRGTVPLDLIGRLSNLSRLELSYNNLTVDASSSNSTSFTFPQLNILKLASCRLQKFPDLKNQSWMMHLDLSDNQILGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLKGDLLIPPCTAIYVDYSSNNLNNSIPTDIGKSLGFASFFSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNRLVDHFPCMLRNSNSLRVLVLRSNKFYGNLMCDVTRNSWQNLQIIDIASNNFTGVLNAEFFSNWRGMMVADDYVETGRNHIQYEFLQLSKLYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGAIPDAIGNLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALNLSFNKLFGKIPSTNQFQTFSADSFEGNSGLCGLPLNNSC

Gene3D: G3DSA:3.80.10.10
32-210 G3DSA:3.80.10.10

QCLDDQKSLLLQFKGSLQYDSTLSKKLAKWNDMTSECCNWNGVTCNLFGHVIALELDDETISSGIENSSALFSLQYLESLNLADNMFNVGIPVGIANLTNLKYLNLSNAGFVGQIPITLSRLTRLVTLDLSTILPFFDQPLKLENPNLSHFIENSTELRELYLDGVDLSSQRTEWCQSL

HMMPfam: PF08263
IPR013210
35-77 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DDQKSLLLQFKGSLQYDSTLSKKLAKWNDMTSECCNWNGVTCN

superfamily: SSF52047
62-308 SSF52047,LRR

NDMTSECCNWNGVTCNLFGHVIALELDDETISSGIENSSALFSLQYLESLNLADNMFNVGIPVGIANLTNLKYLNLSNAGFVGQIPITLSRLTRLVTLDLSTILPFFDQPLKLENPNLSHFIENSTELRELYLDGVDLSSQRTEWCQSLSLHLPNLTVLSLRDCQISGPLDESLSKLHFLSFVQLDQNNLSSTVPEYFANFSNLTTLTLGSCNLQGTFPERIFQVSVLESLDLSINKLLRGSIPIFF

Gene3D: G3DSA:3.80.10.10
213-454 G3DSA:3.80.10.10

HLPNLTVLSLRDCQISGPLDESLSKLHFLSFVQLDQNNLSSTVPEYFANFSNLTTLTLGSCNLQGTFPERIFQVSVLESLDLSINKLLRGSIPIFFRNGSLRRISLSYTNFSGSLPESISNHQNLSRLELSNCNFYGSIPSTMANLRNLGYLDFSFNNFTGSIPYFRLSKKLTYLDLSRNGLTGLLSRAHFEGLSELVHINLGNNLLSGSLPAYIFELPSLQQLFLYRNQFVGQVDEFRNAS

HMMPfam: PF13516
214-230 LRR_6,Leucine Rich repeat

LPNLTVLSLRDCQISGP

superfamily: SSF52058
274-646 SSF52058,LRR

NLQGTFPERIFQVSVLESLDLSINKLLRGSIPIFFRNGSLRRISLSYTNFSGSLPESISNHQNLSRLELSNCNFYGSIPSTMANLRNLGYLDFSFNNFTGSIPYFRLSKKLTYLDLSRNGLTGLLSRAHFEGLSELVHINLGNNLLSGSLPAYIFELPSLQQLFLYRNQFVGQVDEFRNASSSPLDTVDLTNNHLNGSIPKSMFEIERLKVLSLSSNFFRGTVPLDLIGRLSNLSRLELSYNNLTVDASSSNSTSFTFPQLNILKLASCRLQKFPDLKNQSWMMHLDLSDNQILGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLKGDLLIPPCTAIYVDYSSNNLNNSIPTDIGK

HMMPfam: PF13855
383-442 LRR_8,Leucine rich repeat

KLTYLDLSRNGLTGLLSRAHFEGLSELVHINLGNNLLSGSLPAYIFELPSLQQLFLYRNQ

FPrintScan: PR00019
384-397 LEURICHRPT,Leucine-rich repeat signature

LTYLDLSRNGLTGL

Gene3D: G3DSA:3.80.10.10
457-637 G3DSA:3.80.10.10

PLDTVDLTNNHLNGSIPKSMFEIERLKVLSLSSNFFRGTVPLDLIGRLSNLSRLELSYNNLTVDASSSNSTSFTFPQLNILKLASCRLQKFPDLKNQSWMMHLDLSDNQILGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLKGDLLIPPCTAIYVDYSSNNLN

superfamily: SSF52058
624-986 SSF52058,LRR

CTAIYVDYSSNNLNNSIPTDIGKSLGFASFFSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNRLVDHFPCMLRNSNSLRVLVLRSNKFYGNLMCDVTRNSWQNLQIIDIASNNFTGVLNAEFFSNWRGMMVADDYVETGRNHIQYEFLQLSKLYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGAIPDAIGNLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALNLSFNKLFGKIPSTNQFQTFSADSFEGNSGLCGLPLNNSC

Gene3D: G3DSA:3.80.10.10
638-816 G3DSA:3.80.10.10

NSIPTDIGKSLGFASFFSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNRLVDHFPCMLRNSNSLRVLVLRSNKFYGNLMCDVTRNSWQNLQIIDIASNNFTGVLNAEF

HMMPfam: PF13855
656-710 LRR_8,Leucine rich repeat

VANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKL

HMMPfam: PF13855
724-781 LRR_8,Leucine rich repeat

LQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNRLVDHFPCMLRNSNSLRVLVLRSNK

Gene3D: G3DSA:3.80.10.10
871-983 G3DSA:3.80.10.10

FTSIDFSSNRFQGAIPDAIGNLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALNLSFNKLFGKIPSTNQFQTFSADSFEGNSGLCGLPLN

HMMPfam: PF13855
873-929 LRR_8,Leucine rich repeat

SIDFSSNRFQGAIPDAIGNLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHL

FPrintScan: PR00019
892-905 LEURICHRPT,Leucine-rich repeat signature

LSSLYVLNLSHNAL


List of References

Emilie F Fradin, Zhao Zhang, Juan C Juarez Ayala, Christian D M Castroverde, Ross N Nazar, Jane Robb, Chun-Ming Liu, Bart P H J Thomma
Genetic dissection of Verticillium wilt resistance mediated by tomato Ve1.
Plant Physiol.: 2009, 150(1);320-32
PubMed:19321708 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox