PRGDB00062267 (verticillium wilt disease resistance protein)

From PRG Wiki
Jump to: navigation, search
verticillium wilt disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 237899594 (FJ464553)
Gene Class Unknown
Domain Type LRR
Gene Species Solanum lycopersicum

Comment?

Solanum lycopersicum cultivar Craigella GCR218 verticillium wilt disease resistance protein (Ve1) gene, complete cds.

DNA Sequence

ATGAAAATGATGGCAACTCTGTACTTCCTATGGCTTCTCTTGATTCCCTCGTTTCAAATCTTATCAGGATACCACATTTTCTTGGTTTCCTCTCAATGCCTTGACGATCAAAAGTCATTGTTGCTGCAGTTTAAGGGAAGCCTCCAATATGATTCTACTTTGTCAAAGAAATTGGCAAAATGGAACGACATGACAAGTGAATGTTGCAATTGGAATGGGGTTACATGCAATCTCTTTGGTCATGTGATCGCTTTGGAACTGGATGATGAGACTATTTCTAGTGGAATTGAGAATTCTAGTGCACTTTTCAGTCTTCAATATCTTGAGAGCCTAAATTTGGCTGACAACATGTTCAATGTTGGCATACCAGTTGGTATAGCCAACCTCACAAACTTGAAGTACCTGAATTTATCCAATGCTGGTTTTGTCGGGCAAATTCCTATAACATTATCAAGATTAACAAGGCTAGTTACTCTTGATCTCTCAACTATTCTCCCTTTTTTTGATCAGCCACTTAAACTTGAGAATCCCAATTTGAGTCATTTCATTGAGAACTCAACAGAGCTTAGAGAGCTTTACCTTGATGGGGTTGATCTTTCGTCTCAGAGGACTGAGTGGTGTCAATCTTTATCTTTACATTTGCCTAACTTGACCGTTTTGAGCTTGCGTGATTGTCAAATTTCAGGCCCTTTGGATGAATCACTTTCTAAGCTTCACTTTCTCTCTTTTGTCCAACTTGACCAGAACAATCTCTCTAGCACAGTTCCTGAATATTTTGCCAATTTCTCGAACTTGACTACATTGACCCTGGGCTCTTGTAATCTACAGGGAACATTTCCTGAAAGAATCTTTCAGGTATCAGTTTTAGAGAGTTTGGACTTGTCAATTAACAAGTTGCTTCGTGGTAGTATTCCAATTTTTTTCCGAAATGGATCTCTGAGGAGGATATCACTAAGCTACACCAACTTTTCCGGTTCATTACCAGAGTCCATTTCGAACCATCAAAATCTATCCAGGTTAGAGCTTTCTAATTGCAATTTCTATGGATCAATACCTTCCACAATGGCAAACCTTAGAAATCTTGGTTATTTGGATTTCTCCTTCAACAATTTCACTGGTTCTATCCCATATTTTCGACTGTCCAAGAAACTCACCTACTTAGACCTTTCACGTAATGGTCTAACTGGTCTCTTGTCTAGAGCTCATTTTGAAGGACTCTCAGAGCTTGTCCACATTAATTTAGGGAACAATTTACTCAGCGGGAGCCTTCCTGCATATATATTTGAGCTCCCCTCGTTGCAGCAGCTTTTTCTTTACAGAAATCAATTTGTTGGCCAAGTCGACGAATTTCGCAATGCATCCTCCTCTCCGTTGGATACAGTTGACTTGACAAACAACCACCTGAATGGATCGATTCCGAAGTCCATGTTTGAAATTGAAAGGCTTAAGGTGCTCTCACTTTCTTCCAACTTCTTTAGAGGGACAGTGCCCCTTGACCTCATTGGGAGGCTGAGCAACCTTTCAAGACTGGAGCTTTCTTACAATAACTTGACTGTTGATGCAAGTAGCAGCAATTCAACCTCTTTCACATTTCCCCAGTTGAACATATTGAAATTAGCGTCTTGTCGGCTGCAAAAGTTCCCCGATCTCAAGAATCAGTCATGGATGATGCACTTAGACCTTTCAGACAACCAAATATTGGGGGCAATACCAAATTGGATCTGGGGAATTGGTGGTGGAGGTCTCACCCACCTGAATCTTTCATTCAATCAGCTGGAGTACGTGGAACAGCCTTACACTGCTTCCAGCAATCTTGTAGTCCTTGATTTGCATTCCAACCGTTTAAAAGGTGACTTACTAATACCACCTTGCACTGCCATCTATGTGGACTACTCTAGCAATAATTTAAACAATTCCATCCCAACAGATATTGGAAAGTCTCTTGGTTTTGCCTCCTTTTTCTCGGTAGCAAACAATGGCATTACTGGAATAATTCCTGAATCCATATGCAACTGCAGCTACCTTCAAGTTCTTGATTTCTCTAACAATGCCTTGAGTGGAACAATACCACCATGTCTACTGGAATATAGTACAAAACTTGGAGTGCTGAATCTTGGGAACAATAAACTCAATGGTGTTATACCAGATTCATTTTCAATTGGTTGTGCTCTACAAACATTAGACCTCAGTGCGAATAACTTACAAGGCAGGCTGCCAAAATCGATTGTGAATTGTAAGTTGTTGGAGGTCCTGAATGTTGGAAATAACAGACTTGTTGATCATTTCCCATGCATGTTGAGGAACTCAAACAGTCTGAGGGTCCTAGTCTTGCGCTCCAATAAATTCTATGGAAATCTTATGTGTGATGTAACCAGAAATAGCTGGCAGAATCTCCAGATCATAGATATAGCTTCCAACAACTTCACTGGTGTGTTGAATGCAGAATTCTTTTCAAATTGGAGAGGAATGATGGTTGCAGATGATTACGTGGAGACAGGACGCAATCATATCCAGTATGAGTTCTTACAACTAAGTAAATTGTACTATCAGGACACAGTGACATTAACCATCAAAGGCATGGAGCTGGAGCTTGTGAAGATTCTCAGGGTCTTCACATCTATTGATTTCTCTTCCAATAGATTTCAAGGAGCGATACCAGATGCTATCGGGAATCTCAGCTCACTTTATGTTCTGAATCTGTCACACAATGCCCTTGAGGGACCAATCCCAAAATCGATTGGGAAGCTACAAATGCTTGAATCACTAGACCTGTCAACAAACCACCTGTCCGGGGAGATCCCATCAGAGCTTGCAAGTCTCACATTCTTAGCAGCTTTGAACTTATCGTTCAACAAATTGTTTGGCAAAATTCCATCAACTAATCAGTTTCAAACATTCTCAGCAGATTCCTTTGAAGGAAACAGTGGCCTATGCGGGCTCCCTCTCAACAACAGTTGTCAAAGCAATGGCTCAGCCTCAGAGTCCCTGCCTCCACCAACTCCGCTACCAGACTCAGATGATGAATGGGAGTTCATTTTTGCAGCAGTTGGATACATAGTAGGGGCAGCAAATACTATTTCAGTTGTGTGGTTTTACAAGCCAGTGAAGAAATGGTTTGATAAGCATATGGAGAAATGCTTGCTTTGGTTTTCAAGAAAGTGA


Protein sequences

Name Description Sequence
verticillium wilt disease resistance protein verticillium wilt disease resistance protein [Solanum lycopersicum].

MKMMATLYFLWLLLIPSFQILSGYHIFLVSSQCLDDQKSLLLQFKGSLQYDSTLSKKLAKWNDMTSECCNWNGVTCNLFGHVIALELDDETISSGIENSSALFSLQYLESLNLADNMFNVGIPVGIANLTNLKYLNLSNAGFVGQIPITLSRLTRLVTLDLSTILPFFDQPLKLENPNLSHFIENSTELRELYLDGVDLSSQRTEWCQSLSLHLPNLTVLSLRDCQISGPLDESLSKLHFLSFVQLDQNNLSSTVPEYFANFSNLTTLTLGSCNLQGTFPERIFQVSVLESLDLSINKLLRGSIPIFFRNGSLRRISLSYTNFSGSLPESISNHQNLSRLELSNCNFYGSIPSTMANLRNLGYLDFSFNNFTGSIPYFRLSKKLTYLDLSRNGLTGLLSRAHFEGLSELVHINLGNNLLSGSLPAYIFELPSLQQLFLYRNQFVGQVDEFRNASSSPLDTVDLTNNHLNGSIPKSMFEIERLKVLSLSSNFFRGTVPLDLIGRLSNLSRLELSYNNLTVDASSSNSTSFTFPQLNILKLASCRLQKFPDLKNQSWMMHLDLSDNQILGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLKGDLLIPPCTAIYVDYSSNNLNNSIPTDIGKSLGFASFFSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNRLVDHFPCMLRNSNSLRVLVLRSNKFYGNLMCDVTRNSWQNLQIIDIASNNFTGVLNAEFFSNWRGMMVADDYVETGRNHIQYEFLQLSKLYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGAIPDAIGNLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALNLSFNKLFGKIPSTNQFQTFSADSFEGNSGLCGLPLNNSCQSNGSASESLPPPTPLPDSDDEWEFIFAAVGYIVGAANTISVVWFYKPVKKWFDKHMEKCLLWFSRK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
1-986 PTHR24420:SF473,SUBFAMILY NOT NAMED

MKMMATLYFLWLLLIPSFQILSGYHIFLVSSQCLDDQKSLLLQFKGSLQYDSTLSKKLAKWNDMTSECCNWNGVTCNLFGHVIALELDDETISSGIENSSALFSLQYLESLNLADNMFNVGIPVGIANLTNLKYLNLSNAGFVGQIPITLSRLTRLVTLDLSTILPFFDQPLKLENPNLSHFIENSTELRELYLDGVDLSSQRTEWCQSLSLHLPNLTVLSLRDCQISGPLDESLSKLHFLSFVQLDQNNLSSTVPEYFANFSNLTTLTLGSCNLQGTFPERIFQVSVLESLDLSINKLLRGSIPIFFRNGSLRRISLSYTNFSGSLPESISNHQNLSRLELSNCNFYGSIPSTMANLRNLGYLDFSFNNFTGSIPYFRLSKKLTYLDLSRNGLTGLLSRAHFEGLSELVHINLGNNLLSGSLPAYIFELPSLQQLFLYRNQFVGQVDEFRNASSSPLDTVDLTNNHLNGSIPKSMFEIERLKVLSLSSNFFRGTVPLDLIGRLSNLSRLELSYNNLTVDASSSNSTSFTFPQLNILKLASCRLQKFPDLKNQSWMMHLDLSDNQILGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLKGDLLIPPCTAIYVDYSSNNLNNSIPTDIGKSLGFASFFSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNRLVDHFPCMLRNSNSLRVLVLRSNKFYGNLMCDVTRNSWQNLQIIDIASNNFTGVLNAEFFSNWRGMMVADDYVETGRNHIQYEFLQLSKLYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGAIPDAIGNLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALNLSFNKLFGKIPSTNQFQTFSADSFEGNSGLCGLPLNNSC

HMMPanther: PTHR24420
1-986 PTHR24420,FAMILY NOT NAMED

MKMMATLYFLWLLLIPSFQILSGYHIFLVSSQCLDDQKSLLLQFKGSLQYDSTLSKKLAKWNDMTSECCNWNGVTCNLFGHVIALELDDETISSGIENSSALFSLQYLESLNLADNMFNVGIPVGIANLTNLKYLNLSNAGFVGQIPITLSRLTRLVTLDLSTILPFFDQPLKLENPNLSHFIENSTELRELYLDGVDLSSQRTEWCQSLSLHLPNLTVLSLRDCQISGPLDESLSKLHFLSFVQLDQNNLSSTVPEYFANFSNLTTLTLGSCNLQGTFPERIFQVSVLESLDLSINKLLRGSIPIFFRNGSLRRISLSYTNFSGSLPESISNHQNLSRLELSNCNFYGSIPSTMANLRNLGYLDFSFNNFTGSIPYFRLSKKLTYLDLSRNGLTGLLSRAHFEGLSELVHINLGNNLLSGSLPAYIFELPSLQQLFLYRNQFVGQVDEFRNASSSPLDTVDLTNNHLNGSIPKSMFEIERLKVLSLSSNFFRGTVPLDLIGRLSNLSRLELSYNNLTVDASSSNSTSFTFPQLNILKLASCRLQKFPDLKNQSWMMHLDLSDNQILGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLKGDLLIPPCTAIYVDYSSNNLNNSIPTDIGKSLGFASFFSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNRLVDHFPCMLRNSNSLRVLVLRSNKFYGNLMCDVTRNSWQNLQIIDIASNNFTGVLNAEFFSNWRGMMVADDYVETGRNHIQYEFLQLSKLYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGAIPDAIGNLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALNLSFNKLFGKIPSTNQFQTFSADSFEGNSGLCGLPLNNSC

Gene3D: G3DSA:3.80.10.10
32-210 G3DSA:3.80.10.10

QCLDDQKSLLLQFKGSLQYDSTLSKKLAKWNDMTSECCNWNGVTCNLFGHVIALELDDETISSGIENSSALFSLQYLESLNLADNMFNVGIPVGIANLTNLKYLNLSNAGFVGQIPITLSRLTRLVTLDLSTILPFFDQPLKLENPNLSHFIENSTELRELYLDGVDLSSQRTEWCQSL

HMMPfam: PF08263
IPR013210
35-77 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DDQKSLLLQFKGSLQYDSTLSKKLAKWNDMTSECCNWNGVTCN

superfamily: SSF52047
62-308 SSF52047,LRR

NDMTSECCNWNGVTCNLFGHVIALELDDETISSGIENSSALFSLQYLESLNLADNMFNVGIPVGIANLTNLKYLNLSNAGFVGQIPITLSRLTRLVTLDLSTILPFFDQPLKLENPNLSHFIENSTELRELYLDGVDLSSQRTEWCQSLSLHLPNLTVLSLRDCQISGPLDESLSKLHFLSFVQLDQNNLSSTVPEYFANFSNLTTLTLGSCNLQGTFPERIFQVSVLESLDLSINKLLRGSIPIFF

Gene3D: G3DSA:3.80.10.10
213-454 G3DSA:3.80.10.10

HLPNLTVLSLRDCQISGPLDESLSKLHFLSFVQLDQNNLSSTVPEYFANFSNLTTLTLGSCNLQGTFPERIFQVSVLESLDLSINKLLRGSIPIFFRNGSLRRISLSYTNFSGSLPESISNHQNLSRLELSNCNFYGSIPSTMANLRNLGYLDFSFNNFTGSIPYFRLSKKLTYLDLSRNGLTGLLSRAHFEGLSELVHINLGNNLLSGSLPAYIFELPSLQQLFLYRNQFVGQVDEFRNAS

HMMPfam: PF13516
214-230 LRR_6,Leucine Rich repeat

LPNLTVLSLRDCQISGP

superfamily: SSF52058
274-646 SSF52058,LRR

NLQGTFPERIFQVSVLESLDLSINKLLRGSIPIFFRNGSLRRISLSYTNFSGSLPESISNHQNLSRLELSNCNFYGSIPSTMANLRNLGYLDFSFNNFTGSIPYFRLSKKLTYLDLSRNGLTGLLSRAHFEGLSELVHINLGNNLLSGSLPAYIFELPSLQQLFLYRNQFVGQVDEFRNASSSPLDTVDLTNNHLNGSIPKSMFEIERLKVLSLSSNFFRGTVPLDLIGRLSNLSRLELSYNNLTVDASSSNSTSFTFPQLNILKLASCRLQKFPDLKNQSWMMHLDLSDNQILGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLKGDLLIPPCTAIYVDYSSNNLNNSIPTDIGK

HMMPfam: PF13855
383-442 LRR_8,Leucine rich repeat

KLTYLDLSRNGLTGLLSRAHFEGLSELVHINLGNNLLSGSLPAYIFELPSLQQLFLYRNQ

FPrintScan: PR00019
384-397 LEURICHRPT,Leucine-rich repeat signature

LTYLDLSRNGLTGL

Gene3D: G3DSA:3.80.10.10
457-637 G3DSA:3.80.10.10

PLDTVDLTNNHLNGSIPKSMFEIERLKVLSLSSNFFRGTVPLDLIGRLSNLSRLELSYNNLTVDASSSNSTSFTFPQLNILKLASCRLQKFPDLKNQSWMMHLDLSDNQILGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLKGDLLIPPCTAIYVDYSSNNLN

superfamily: SSF52058
624-986 SSF52058,LRR

CTAIYVDYSSNNLNNSIPTDIGKSLGFASFFSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNRLVDHFPCMLRNSNSLRVLVLRSNKFYGNLMCDVTRNSWQNLQIIDIASNNFTGVLNAEFFSNWRGMMVADDYVETGRNHIQYEFLQLSKLYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGAIPDAIGNLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALNLSFNKLFGKIPSTNQFQTFSADSFEGNSGLCGLPLNNSC

Gene3D: G3DSA:3.80.10.10
638-816 G3DSA:3.80.10.10

NSIPTDIGKSLGFASFFSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNRLVDHFPCMLRNSNSLRVLVLRSNKFYGNLMCDVTRNSWQNLQIIDIASNNFTGVLNAEF

HMMPfam: PF13855
656-710 LRR_8,Leucine rich repeat

VANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKL

HMMPfam: PF13855
724-781 LRR_8,Leucine rich repeat

LQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNRLVDHFPCMLRNSNSLRVLVLRSNK

Gene3D: G3DSA:3.80.10.10
871-983 G3DSA:3.80.10.10

FTSIDFSSNRFQGAIPDAIGNLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALNLSFNKLFGKIPSTNQFQTFSADSFEGNSGLCGLPLN

HMMPfam: PF13855
873-929 LRR_8,Leucine rich repeat

SIDFSSNRFQGAIPDAIGNLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHL

FPrintScan: PR00019
892-905 LEURICHRPT,Leucine-rich repeat signature

LSSLYVLNLSHNAL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox