PRGDB00062269 (putative disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 237769812 (AB470472)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana at5g45260 mRNA for putative disease resistance protein, complete cds, ecotype: RLD-0.

DNA Sequence

ATGACCAATTGTGAAAAGGATGAGGAATTCGTGTGCATCAGCTGCGTAGAAGAGGTACGGTACTCTTTCGTGAGCCACCTCTCTGAAGCTCTCCGTCGAAAAGGCATAAATAATGTGGTCGTAGATGTAGATATCGATGATCTGCTTTTCAAGGAGTCTCAGGCAAAGATCGAGAAAGCTGGGGTTTCTGTGATGGTTTTACCCGGAAACTGTGATCCTTCCGAGGTATGGCTTGACAAGTTCGCCAAGGTTCTCGAGTGCCAAAGGAACAACAAGGACCAGGCGGTGGTTTCAGTGTTGTACGGTGACAGTCTATTACGGGACCAATGGCTTAGCGAGCTGGATTTCAGAGGCTTATCACGAATTCACCAATCCAGGAAGGAATGTAGTGACTCTATACTTGTAGAAGAGATTGTGAGAGATGTGTACGAGACGCACTTTTATGTTGGACGAATTGGAATCTATTCGAAGCTGCTGGAGATTGAAAACATGGTTAACAAGCAACCGATAGGCATCCGTTGTGTTGGAATTTGGGGTATGCCTGGCATAGGAAAGACAACACTTGCTAAAGCAGTCTTTGACCAAATGTCTAGCGCCTTTGATGCTTCTTGTTTTATCGAAGACTATGACAAATCAATTCATGAGAAGGGTCTTTATTGTTTGCTGGAGGAACAACTTTTGCCGGGTAATGATGCAACCATTATGAAACTGAACTCGCTCAGAGACAGATTGAACAGTAAGAGAGTTCTTGTTGTTCTCGATGACGTGTGCAATGCTCTGGTTGCAGAGTCTTTTCTCGAGGGGTTTGACTGGCTAGGACCCGGAAGCCTGATCATCATAACCTCTAGAGATAAACAAGTGTTTCGCCTTTGCGGAATCAATCAAATATATGAGGTCCAGGGTTTAAATGAGAAAGAGGCTCGTCAACTTTTCTTGCTGTCTGCGTCTATAAAGGAGGATATGGGAGAGCAGAATCTCCATGAGTTGTCAGTGAGAGTAATAAGTTACGCTAATGGAAACCCGTTAGCTATCAGTGTTTATGGAAGAGAGCTGAAAGGTAAGAAAAAACTCTCAGAAATGGAGACTGCATTCCTCAAACTCAAGCGACGTCCTCCATTTAAGATTGTCGATGCATTTAAAAGCAGCTACGACACACTCAGTGACAACGAAAAGAACATTTTTTTGGACATAGCTTGTTTTTTCCAGGGAGAAAATGTCAACTACGTGATACAACTGCTTGAGGGTTGTGGTTTCTTTCCACATGTTGAAATTGATGTCCTTGTTGACAAGTGTCTGGTGACTATTTCAGAAAACCGAGTTTGGTTGCATAAGCTGACCCAGGATATCGGCCGAGAAATCATAAATGGAGAAACAGTACAGATCGAGAGGCGCAGAAGACTGTGGGAACCTTGGAGCATCAAATATTTATTAGAATATAATGAACACAAAGCAAATGGAGAACCTAAAACAACCTTCAAACGTGCTCAGGGCTCTGAAGAGATCGAAGGCCTGTTTCTAGACACATCAAACTTAAGATTTGATCTGCAGCCCTCTGCCTTTAAGAATATGTTGAACCTTAGATTGCTCAAAATTTATTGTTCCAATCCTGAAGTCCATCCTGTAATCAATTTCCCAACAGGCTCTCTGCATTCTCTTCCTAATGAGCTAAGACTCCTCCATTGGGAGAACTATCCTCTGAAATCTTTGCCTCAGAATTTTGATCCTAGGCACCTTGTCGAAATCAACATGCCGTATAGTCAACTTCAGAAACTTTGGGGTGGAACCAAGAACCTGGAGATGTTGAGGACGATCAGGCTTTGCCATTCCCAGCATCTAGTTGATATCGATGATCTCTTAAAAGCTGAAAATCTTGAGGTAATTGATCTCCAAGGTTGTACGAGACTGCAGAATTTCCCAGCCGCAGGTCGATTGCTACGTCTACGAGTTGTAAATCTCTCAGGTTGCATAAAGATTAAAAGTGTCCTAGAAATTCCACCAAATATTGAGAAACTACATCTACAGGGAACTGGCATATTAGCATTACCAGTTTCCACTGTTAAGCCAAACCATAGAGAGCTTGTGAATTTTCTAACAGAAATTCCGGGTCTTTCAGAGGCCTCGAAACTTGAGCGTTTAACAAGTCTGCTGGAATCTAACTCATCTTGTCAAGATCTTGGGAAGCTTATTTGCTTGGAGCTGAAAGATTGCTCTTGTTTGCAGAGTCTGCCAAACATGGCTAATTTAGATCTTAATGTTCTTGATCTCTCGGGTTGCTCAAGTCTTAATTCTATTCAGGGTTTCCCTCGTTTTCTGAAACAGTTATATCTTGGTGGCACTGCAATAAGAGAAGTGCCACAACTTCCTCAAAGTCTAGAAATCTTGAATGCACATGGATCTTGTTTGCGAAGTCTGCCAAACATGGCTAATTTAGAATTTCTCAAAGTTCTTGATCTCTCTGGTTGCTCAGAGCTCGAGACTATTCAGGGTTTTCCTCGGAACCTAAAAGAGTTATATTTTGCTGGCACTACGTTAAGAGAAGTGCCCCAACTTCCTTTAAGCCTAGAGGTCTTGAATGCACATGGTTCTGACTCGGAGAAGCTTCCTATGCATTACAAGTTCAACAATTTTTTCGATCTATCTCAACAAGTGGTCAACGATTTTTTCTTGAAAGCGCTGACTTATGTAAAACACATACCAAGAGGGTATACGCAGGAACTCATCAACAAAGCTCCGACTTTCAGCTTCAGTGCGCCCTCACATACAAATCAAAACGCCACATTTGATCTGCAACCAGGATCTTCTGTAATGACACGACTAAATCATTCATGGAGGAACACGCTTGTGGGATTTGGTATGCTGGTGGAAGTTGCATTTCCCGAGGACTACTGTGATGCTACAGATGTTGGCATAAGTTGTGTTTGCAGATGGAGCAACAAAGAAGGCCGCTCTTGTAGGATAGAAAGAAATTTTCATTGTTGGGCACCAGGGAAAGTTGTTCCAAAAGTTCGAAAGGATCATACGTTTGTCTTTAGTGATGTCAACATGCGCCCAAGTACCGGTGAAGGAAATGACCCTGATATCTGGGCTGGATTAGTTGTATTTGAGTTCTTTCCTATCAATCAGCAGACAAAGTGTCTAAATGATAGGTTCACAGTGACAAGATGTGGAGTCCGTGTAATAAATGTTGCAACTGGCAATACAAGTCTTGAGAACATATCACTAGTTTTGTCTTTGGATCCAGTGGAGGTTTCTGGTTATGAAGTATTGAGAGTCAGCTATGATGATTTACAGGAGATGGATAAAGTTCTATTTCTTTACATAGCGTCTTTGTTCAATGACGAGGATGTTGATTTTGTGGCACCACTTATTGCCGGTATTGACTTGGATGTTAGCTCTGGGCTCAAGGTCTTAGCCGATGTGTCTCTCATAAGTGTATCATCCAATGGGGAAATAGTGATGCATAGTTTGCAAAGACAAATGGGCAAAGAAATCCTCCATGGACAATCCATGCTGCTGTCTGATTGTGAGAGTTCCATGACCGAGAATTTGTCTGACGTACCAAAAAAGGAGAAGAAACATCGCGAAAGTAAGGTAAAGAAAGTGGTTTCCATACCGGCTATAGACGAGGGAGATCTATGGACTTGGCGAAAGTACGGTCAAAAAGACATCTTAGGTTCTCGTTTTCCAAGGGGTTACTACAGGTGCGCTTACAAGTTCACGCATGGTTGTAAAGCTACAAAACAAGTCCAACGGAGCGAGACCGATTCAAACATGTTAGCTATTACTTACCTATCTGAGCATAACCATCCACGGCCCACTAAACGCAAGGCTCTCGCTGACTCCACTCGTTCCACTTCCTCCTCCATCTGCTCAGCCATAACTACCTCTGCCTCATCTAGAGTCTTCCAAAACAAAGACGAACCAAATAAACCCCACTTGCCTTCCTCCTCCACTCCTCCTGGAAACGCGGCTGTCTTGTTTAAAATGACGGACATGGAGGAGTTTCAGGACAATATGGAGGTGGATAATGACGTCGTAGATACACGTACACTGGCATTGTTTCCAGAGTTTCAACATCAGCCGGAGGAAGAATACCCATGGTCAACATTCTTCGATGATTAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MTNCEKDEEFVCISCVEEVRYSFVSHLSEALRRKGINNVVVDVDIDDLLFKESQAKIEKAGVSVMVLPGNCDPSEVWLDKFAKVLECQRNNKDQAVVSVLYGDSLLRDQWLSELDFRGLSRIHQSRKECSDSILVEEIVRDVYETHFYVGRIGIYSKLLEIENMVNKQPIGIRCVGIWGMPGIGKTTLAKAVFDQMSSAFDASCFIEDYDKSIHEKGLYCLLEEQLLPGNDATIMKLNSLRDRLNSKRVLVVLDDVCNALVAESFLEGFDWLGPGSLIIITSRDKQVFRLCGINQIYEVQGLNEKEARQLFLLSASIKEDMGEQNLHELSVRVISYANGNPLAISVYGRELKGKKKLSEMETAFLKLKRRPPFKIVDAFKSSYDTLSDNEKNIFLDIACFFQGENVNYVIQLLEGCGFFPHVEIDVLVDKCLVTISENRVWLHKLTQDIGREIINGETVQIERRRRLWEPWSIKYLLEYNEHKANGEPKTTFKRAQGSEEIEGLFLDTSNLRFDLQPSAFKNMLNLRLLKIYCSNPEVHPVINFPTGSLHSLPNELRLLHWENYPLKSLPQNFDPRHLVEINMPYSQLQKLWGGTKNLEMLRTIRLCHSQHLVDIDDLLKAENLEVIDLQGCTRLQNFPAAGRLLRLRVVNLSGCIKIKSVLEIPPNIEKLHLQGTGILALPVSTVKPNHRELVNFLTEIPGLSEASKLERLTSLLESNSSCQDLGKLICLELKDCSCLQSLPNMANLDLNVLDLSGCSSLNSIQGFPRFLKQLYLGGTAIREVPQLPQSLEILNAHGSCLRSLPNMANLEFLKVLDLSGCSELETIQGFPRNLKELYFAGTTLREVPQLPLSLEVLNAHGSDSEKLPMHYKFNNFFDLSQQVVNDFFLKALTYVKHIPRGYTQELINKAPTFSFSAPSHTNQNATFDLQPGSSVMTRLNHSWRNTLVGFGMLVEVAFPEDYCDATDVGISCVCRWSNKEGRSCRIERNFHCWAPGKVVPKVRKDHTFVFSDVNMRPSTGEGNDPDIWAGLVVFEFFPINQQTKCLNDRFTVTRCGVRVINVATGNTSLENISLVLSLDPVEVSGYEVLRVSYDDLQEMDKVLFLYIASLFNDEDVDFVAPLIAGIDLDVSSGLKVLADVSLISVSSNGEIVMHSLQRQMGKEILHGQSMLLSDCESSMTENLSDVPKKEKKHRESKVKKVVSIPAIDEGDLWTWRKYGQKDILGSRFPRGYYRCAYKFTHGCKATKQVQRSETDSNMLAITYLSEHNHPRPTKRKALADSTRSTSSSICSAITTSASSRVFQNKDEPNKPHLPSSSTPPGNAAVLFKMTDMEEFQDNMEVDNDVVDTRTLALFPEFQHQPEEEYPWSTFFDD

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF20
1-1233 PTHR11017:SF20,SUBFAMILY NOT NAMED

MTNCEKDEEFVCISCVEEVRYSFVSHLSEALRRKGINNVVVDVDIDDLLFKESQAKIEKAGVSVMVLPGNCDPSEVWLDKFAKVLECQRNNKDQAVVSVLYGDSLLRDQWLSELDFRGLSRIHQSRKECSDSILVEEIVRDVYETHFYVGRIGIYSKLLEIENMVNKQPIGIRCVGIWGMPGIGKTTLAKAVFDQMSSAFDASCFIEDYDKSIHEKGLYCLLEEQLLPGNDATIMKLNSLRDRLNSKRVLVVLDDVCNALVAESFLEGFDWLGPGSLIIITSRDKQVFRLCGINQIYEVQGLNEKEARQLFLLSASIKEDMGEQNLHELSVRVISYANGNPLAISVYGRELKGKKKLSEMETAFLKLKRRPPFKIVDAFKSSYDTLSDNEKNIFLDIACFFQGENVNYVIQLLEGCGFFPHVEIDVLVDKCLVTISENRVWLHKLTQDIGREIINGETVQIERRRRLWEPWSIKYLLEYNEHKANGEPKTTFKRAQGSEEIEGLFLDTSNLRFDLQPSAFKNMLNLRLLKIYCSNPEVHPVINFPTGSLHSLPNELRLLHWENYPLKSLPQNFDPRHLVEINMPYSQLQKLWGGTKNLEMLRTIRLCHSQHLVDIDDLLKAENLEVIDLQGCTRLQNFPAAGRLLRLRVVNLSGCIKIKSVLEIPPNIEKLHLQGTGILALPVSTVKPNHRELVNFLTEIPGLSEASKLERLTSLLESNSSCQDLGKLICLELKDCSCLQSLPNMANLDLNVLDLSGCSSLNSIQGFPRFLKQLYLGGTAIREVPQLPQSLEILNAHGSCLRSLPNMANLEFLKVLDLSGCSELETIQGFPRNLKELYFAGTTLREVPQLPLSLEVLNAHGSDSEKLPMHYKFNNFFDLSQQVVNDFFLKALTYVKHIPRGYTQELINKAPTFSFSAPSHTNQNATFDLQPGSSVMTRLNHSWRNTLVGFGMLVEVAFPEDYCDATDVGISCVCRWSNKEGRSCRIERNFHCWAPGKVVPKVRKDHTFVFSDVNMRPSTGEGNDPDIWAGLVVFEFFPINQQTKCLNDRFTVTRCGVRVINVATGNTSLENISLVLSLDPVEVSGYEVLRVSYDDLQEMDKVLFLYIASLFNDEDVDFVAPLIAGIDLDVSSGLKVLADVSLISVSSNGEIVMHSLQRQMGKEILHGQSMLLSDCESSMTENLSDVPKKEKKHRESKVKKVVSIPAIDEGDLWTWRKYGQKDILGSRFPRGYY

HMMPanther: PTHR11017
1-1233 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MTNCEKDEEFVCISCVEEVRYSFVSHLSEALRRKGINNVVVDVDIDDLLFKESQAKIEKAGVSVMVLPGNCDPSEVWLDKFAKVLECQRNNKDQAVVSVLYGDSLLRDQWLSELDFRGLSRIHQSRKECSDSILVEEIVRDVYETHFYVGRIGIYSKLLEIENMVNKQPIGIRCVGIWGMPGIGKTTLAKAVFDQMSSAFDASCFIEDYDKSIHEKGLYCLLEEQLLPGNDATIMKLNSLRDRLNSKRVLVVLDDVCNALVAESFLEGFDWLGPGSLIIITSRDKQVFRLCGINQIYEVQGLNEKEARQLFLLSASIKEDMGEQNLHELSVRVISYANGNPLAISVYGRELKGKKKLSEMETAFLKLKRRPPFKIVDAFKSSYDTLSDNEKNIFLDIACFFQGENVNYVIQLLEGCGFFPHVEIDVLVDKCLVTISENRVWLHKLTQDIGREIINGETVQIERRRRLWEPWSIKYLLEYNEHKANGEPKTTFKRAQGSEEIEGLFLDTSNLRFDLQPSAFKNMLNLRLLKIYCSNPEVHPVINFPTGSLHSLPNELRLLHWENYPLKSLPQNFDPRHLVEINMPYSQLQKLWGGTKNLEMLRTIRLCHSQHLVDIDDLLKAENLEVIDLQGCTRLQNFPAAGRLLRLRVVNLSGCIKIKSVLEIPPNIEKLHLQGTGILALPVSTVKPNHRELVNFLTEIPGLSEASKLERLTSLLESNSSCQDLGKLICLELKDCSCLQSLPNMANLDLNVLDLSGCSSLNSIQGFPRFLKQLYLGGTAIREVPQLPQSLEILNAHGSCLRSLPNMANLEFLKVLDLSGCSELETIQGFPRNLKELYFAGTTLREVPQLPLSLEVLNAHGSDSEKLPMHYKFNNFFDLSQQVVNDFFLKALTYVKHIPRGYTQELINKAPTFSFSAPSHTNQNATFDLQPGSSVMTRLNHSWRNTLVGFGMLVEVAFPEDYCDATDVGISCVCRWSNKEGRSCRIERNFHCWAPGKVVPKVRKDHTFVFSDVNMRPSTGEGNDPDIWAGLVVFEFFPINQQTKCLNDRFTVTRCGVRVINVATGNTSLENISLVLSLDPVEVSGYEVLRVSYDDLQEMDKVLFLYIASLFNDEDVDFVAPLIAGIDLDVSSGLKVLADVSLISVSSNGEIVMHSLQRQMGKEILHGQSMLLSDCESSMTENLSDVPKKEKKHRESKVKKVVSIPAIDEGDLWTWRKYGQKDILGSRFPRGYY

Gene3D: G3DSA:3.40.50.300
162-283 G3DSA:3.40.50.300

ENMVNKQPIGIRCVGIWGMPGIGKTTLAKAVFDQMSSAFDASCFIEDYDKSIHEKGLYCLLEEQLLPGNDATIMKLNSLRDRLNSKRVLVVLDDVCNALVAESFLEGFDWLGPGSLIIITSR

HMMPfam: PF00931
IPR002182
170-421 NB-ARC,NBS
NB-ARC

IGIRCVGIWGMPGIGKTTLAKAVFDQMSSAFDASCFIEDYDKSIHEKGLYCLLEEQLLPGNDATIMKLNSLRDRLNSKRVLVVLDDVCNALVAESFLEGFDWLGPGSLIIITSRDKQVFRLCGINQIYEVQGLNEKEARQLFLLSASIKEDMGEQNLHELSVRVISYANGNPLAISVYGRELKGKKKLSEMETAFLKLKRRPPFKIVDAFKSSYDTLSDNEKNIFLDIACFFQGENVNYVIQLLEGCGFFPH

superfamily: SSF52540
170-375 SSF52540

IGIRCVGIWGMPGIGKTTLAKAVFDQMSSAFDASCFIEDYDKSIHEKGLYCLLEEQLLPGNDATIMKLNSLRDRLNSKRVLVVLDDVCNALVAESFLEGFDWLGPGSLIIITSRDKQVFRLCGINQIYEVQGLNEKEARQLFLLSASIKEDMGEQNLHELSVRVISYANGNPLAISVYGRELKGKKKLSEMETAFLKLKRRPPFKI

FPrintScan: PR00364
IPR000767
174-189 DISEASERSIST
Disease resistance protein

CVGIWGMPGIGKTTLA

FPrintScan: PR00364
IPR000767
243-257 DISEASERSIST
Disease resistance protein

RLNSKRVLVVLDDVC

FPrintScan: PR00364
IPR000767
337-351 DISEASERSIST
Disease resistance protein

ANGNPLAISVYGREL

superfamily: SSF46785
373-478 SSF46785

FKIVDAFKSSYDTLSDNEKNIFLDIACFFQGENVNYVIQLLEGCGFFPHVEIDVLVDKCLVTISENRVWLHKLTQDIGREIINGETVQIERRRRLWEPWSIKYLLE

Gene3D: G3DSA:3.80.10.10
514-704 G3DSA:3.80.10.10

DLQPSAFKNMLNLRLLKIYCSNPEVHPVINFPTGSLHSLPNELRLLHWENYPLKSLPQNFDPRHLVEINMPYSQLQKLWGGTKNLEMLRTIRLCHSQHLVDIDDLLKAENLEVIDLQGCTRLQNFPAAGRLLRLRVVNLSGCIKIKSVLEIPPNIEKLHLQGTGILALPVSTVKPNHRELVNFLTEIPGLS

superfamily: SSF52058
517-861 SSF52058,LRR

PSAFKNMLNLRLLKIYCSNPEVHPVINFPTGSLHSLPNELRLLHWENYPLKSLPQNFDPRHLVEINMPYSQLQKLWGGTKNLEMLRTIRLCHSQHLVDIDDLLKAENLEVIDLQGCTRLQNFPAAGRLLRLRVVNLSGCIKIKSVLEIPPNIEKLHLQGTGILALPVSTVKPNHRELVNFLTEIPGLSEASKLERLTSLLESNSSCQDLGKLICLELKDCSCLQSLPNMANLDLNVLDLSGCSSLNSIQGFPRFLKQLYLGGTAIREVPQLPQSLEILNAHGSCLRSLPNMANLEFLKVLDLSGCSELETIQGFPRNLKELYFAGTTLREVPQLPLSLEVLNAHG

HMMPfam: PF07725
IPR011713
577-596 LRR_3
Leucine-rich repeat 3

HLVEINMPYSQLQKLWGGTK

Gene3D: G3DSA:3.80.10.10
705-870 G3DSA:3.80.10.10

EASKLERLTSLLESNSSCQDLGKLICLELKDCSCLQSLPNMANLDLNVLDLSGCSSLNSIQGFPRFLKQLYLGGTAIREVPQLPQSLEILNAHGSCLRSLPNMANLEFLKVLDLSGCSELETIQGFPRNLKELYFAGTTLREVPQLPLSLEVLNAHGSDSEKLPMH

FPrintScan: PR00364
IPR000767
808-824 DISEASERSIST
Disease resistance protein

ANLEFLKVLDLSGCSEL

superfamily: SSF46785
1083-1171 SSF46785

VSGYEVLRVSYDDLQEMDKVLFLYIASLFNDEDVDFVAPLIAGIDLDVSSGLKVLADVSLISVSSNGEIVMHSLQRQMGKEILHGQSML

superfamily: SSF118290
IPR003657
1200-1273 SSF118290
DNA-binding WRKY

KVVSIPAIDEGDLWTWRKYGQKDILGSRFPRGYYRCAYKFTHGCKATKQVQRSETDSNMLAITYLSEHNHPRPT

Gene3D: G3DSA:2.20.25.80
IPR003657
1207-1272 WRKY_DNA-bd
DNA-binding WRKY

IDEGDLWTWRKYGQKDILGSRFPRGYYRCAYKFTHGCKATKQVQRSETDSNMLAITYLSEHNHPRP

HMMSmart: SM00774
IPR003657
1209-1271 WRKY
DNA-binding WRKY

EGDLWTWRKYGQKDILGSRFPRGYYRCAYKFTHGCKATKQVQRSETDSNMLAITYLSEHNHPR

HMMPfam: PF03106
IPR003657
1211-1270 WRKY
DNA-binding WRKY

DLWTWRKYGQKDILGSRFPRGYYRCAYKFTHGCKATKQVQRSETDSNMLAITYLSEHNHP

ProfileScan: PS50811
IPR003657
1211-1272 WRKY
DNA-binding WRKY

DLWTWRKYGQKDILGSRFPRGYYRCAYKFTHGCKATKQVQRSETDSNMLAITYLSEHNHPRP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox