PRGDB00062271 (verticillium wilt disease resistance protein)

From PRG Wiki
Jump to: navigation, search
verticillium wilt disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 228481319 (FJ686046)
Gene Class Unknown
Domain Type LRR
Gene Species Solanum lycopersicum

Comment?

Solanum lycopersicum cultivar Bush Celebrity verticillium wilt disease resistance protein (Ve1) gene, partial cds.

DNA Sequence

TTTGAGCTTGCGTGATTGTCAAATTTCAGGCCCTTTGGATGAATCACTTTCTAAGCTTCACTTTCTCTCTTTTGTCCAACTTGACCAGAACAATCTCTCTAGCACAGTTCCTGAATATTTTGCCAATTTCTCGAACTTGACTACATTGACCCTGGGCTCTTGTAATCTACAGGGAACATTTCCTGAAAGAATCTTTCAGGTATCAGTTTTAGAGAGTTTGGACTTGTCAATTAACAAGTTGCTTCGTGGTAGTATTCCAATTTTTTTCCGAAATGGATCTCTGAGGAGGATATCACTAAGCTACACCAACTTTTCCGGTTCATTACCAGAGTCCATTTCGAACCATCAAAATCTATCCAGGTTAGAGCTTTCTAATTGCAATTTCTATGGATCAATACCTTCCACAATGGCAAACCTTAGAAATCTTGGTTATTTGGATTTCTCCTTCAACAATTTCACTGGTTCTATCCCATATTTTCGACTGTCCAAGAAACTCACCTACTTAGACCTTTCACGTAATGGTCTAACTGGTCTCTTGTCTAGAGCTCATTTTGAAGGACTCTCAGAGCTTGTCCACATTAATTTAGGGAACAATTTACTCAGCGGGAGCCTTCCTGCATATATATTTGAGCTCCCCTCGTTGCAGCAGCTTTTTCTTTACAGAAATCAATTTGTTGGCCAAGTCGACGAATTTCGCAATGCATCCTCCTCTCCGTTGGATACAGTTGACTTGACAAACAACCACCTGAATGGATCGATTCCGAAGTCCATGTTTGAAATTGAAAGGCTTAAGGTGCTCTCACTTTCTTCCAACTTCTTTAGAGGGACAGTGCCCCTTGACCTCATTGGGAGGCTGAGCAACCTTTCAAGACTGGAGCTTTCTTACAATAACTTGACTGTTGATGCAAGTAGCAGCAATTCAACCTCTTTCACATTTCCCCAGTTGAACATATTGAAATTAGCGTCTTGTCGGCTGCAAAAGTTCCCCGATCTCAA


Protein sequences

Name Description Sequence
verticillium wilt disease resistance protein verticillium wilt disease resistance protein [Solanum lycopersicum].

LSLRDCQISGPLDESLSKLHFLSFVQLDQNNLSSTVPEYFANFSNLTTLTLGSCNLQGTFPERIFQVSVLESLDLSINKLLRGSIPIFFRNGSLRRISLSYTNFSGSLPESISNHQNLSRLELSNCNFYGSIPSTMANLRNLGYLDFSFNNFTGSIPYFRLSKKLTYLDLSRNGLTGLLSRAHFEGLSELVHINLGNNLLSGSLPAYIFELPSLQQLFLYRNQFVGQVDEFRNASSSPLDTVDLTNNHLNGSIPKSMFEIERLKVLSLSSNFFRGTVPLDLIGRLSNLSRLELSYNNLTVDASSSNSTSFTFPQLNILKLASCRLQKFPDL


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
1-220 G3DSA:3.80.10.10

LSLRDCQISGPLDESLSKLHFLSFVQLDQNNLSSTVPEYFANFSNLTTLTLGSCNLQGTFPERIFQVSVLESLDLSINKLLRGSIPIFFRNGSLRRISLSYTNFSGSLPESISNHQNLSRLELSNCNFYGSIPSTMANLRNLGYLDFSFNNFTGSIPYFRLSKKLTYLDLSRNGLTGLLSRAHFEGLSELVHINLGNNLLSGSLPAYIFELPSLQQLFLY

HMMPanther: PTHR24420
1-331 PTHR24420,FAMILY NOT NAMED

LSLRDCQISGPLDESLSKLHFLSFVQLDQNNLSSTVPEYFANFSNLTTLTLGSCNLQGTFPERIFQVSVLESLDLSINKLLRGSIPIFFRNGSLRRISLSYTNFSGSLPESISNHQNLSRLELSNCNFYGSIPSTMANLRNLGYLDFSFNNFTGSIPYFRLSKKLTYLDLSRNGLTGLLSRAHFEGLSELVHINLGNNLLSGSLPAYIFELPSLQQLFLYRNQFVGQVDEFRNASSSPLDTVDLTNNHLNGSIPKSMFEIERLKVLSLSSNFFRGTVPLDLIGRLSNLSRLELSYNNLTVDASSSNSTSFTFPQLNILKLASCRLQKFPDL

superfamily: SSF52047
1-326 SSF52047,LRR

LSLRDCQISGPLDESLSKLHFLSFVQLDQNNLSSTVPEYFANFSNLTTLTLGSCNLQGTFPERIFQVSVLESLDLSINKLLRGSIPIFFRNGSLRRISLSYTNFSGSLPESISNHQNLSRLELSNCNFYGSIPSTMANLRNLGYLDFSFNNFTGSIPYFRLSKKLTYLDLSRNGLTGLLSRAHFEGLSELVHINLGNNLLSGSLPAYIFELPSLQQLFLYRNQFVGQVDEFRNASSSPLDTVDLTNNHLNGSIPKSMFEIERLKVLSLSSNFFRGTVPLDLIGRLSNLSRLELSYNNLTVDASSSNSTSFTFPQLNILKLASCRLQ

HMMPfam: PF13855
22-80 LRR_8,Leucine rich repeat

LSFVQLDQNNLSSTVPEYFANFSNLTTLTLGSCNLQGTFPERIFQVSVLESLDLSINKL

HMMPfam: PF00560
IPR001611
93-114 LRR_1
Leucine-rich repeat

SLRRISLSYTNFSGSLPESISN

HMMPfam: PF00560
IPR001611
117-138 LRR_1
Leucine-rich repeat

NLSRLELSNCNFYGSIPSTMAN

HMMPfam: PF00560
IPR001611
141-159 LRR_1
Leucine-rich repeat

NLGYLDFSFNNFTGSIPYF

HMMPfam: PF13855
164-223 LRR_8,Leucine rich repeat

KLTYLDLSRNGLTGLLSRAHFEGLSELVHINLGNNLLSGSLPAYIFELPSLQQLFLYRNQ

FPrintScan: PR00019
165-178 LEURICHRPT,Leucine-rich repeat signature

LTYLDLSRNGLTGL

Gene3D: G3DSA:3.80.10.10
221-330 G3DSA:3.80.10.10

RNQFVGQVDEFRNASSSPLDTVDLTNNHLNGSIPKSMFEIERLKVLSLSSNFFRGTVPLDLIGRLSNLSRLELSYNNLTVDASSSNSTSFTFPQLNILKLASCRLQKFPD

FPrintScan: PR00019
285-298 LEURICHRPT,Leucine-rich repeat signature

LSNLSRLELSYNNL

HMMPfam: PF13516
285-303 LRR_6,Leucine Rich repeat

LSNLSRLELSYNNLTVDAS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox