PRGDB00062272 (disease resistance protein I-2)

From PRG Wiki
Jump to: navigation, search
disease resistance protein I-2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 226374406 (FJ817610)
Gene Class NL
Domain Type NBS, LRR
Gene Species Solanum lycopersicum

Comment?

Solanum lycopersicum cultivar Bush Celebrity disease resistance protein I-2 (I-2) gene, partial cds.

DNA Sequence

TTGATGATGGGAAATGAGCAAATTCGCATGGGCAATTTGTCTACCGAAGCCTCTTGGTCTTTATTTCAAAGACATGCATTTGAAAACATGGATCCTATGGGACATCCGGAACTTGAAGAGGTCGGAAGACAAATTGCAGCCAAGTGCAAAGGACTGCCCTTAGCTCTGAAGACGCTCGCTGGCATGTTACGCTCCAAATCAGAGGTTGAAGAGTGGAAACGTATTTTGAGAAGTGAAATATGGGAGCTGCCACACAATGACATATTACCAGCGTTGATGTTGAGCTACAATGATCTTCCCGCACATTTAAAGCGATGCTTTTCTTTTTGTGCAATATTTCCTAAAGATTATCCATTTAGGAAAGAACAAGTTATTCATCTATGGATTGCCAATGGTCTCGTACCAGTG


Protein sequences

Name Description Sequence
disease resistance protein I-2 disease resistance protein I-2 [Solanum lycopersicum].

LMMGNEQIRMGNLSTEASWSLFQRHAFENMDPMGHPELEEVGRQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRKEQVIHLWIANGLVPV

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
5-135 NB-ARC,NBS
NB-ARC

NEQIRMGNLSTEASWSLFQRHAFENMDPMGHPELEEVGRQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRKEQVIHLWIANGLVP

superfamily: SSF52540
6-86 SSF52540

EQIRMGNLSTEASWSLFQRHAFENMDPMGHPELEEVGRQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHN

HMMPanther: PTHR11017:SF28
19-134 PTHR11017:SF28

WSLFQRHAFENMDPMGHPELEEVGRQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRKEQVIHLWIANGLV

HMMPanther: PTHR11017
19-134 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

WSLFQRHAFENMDPMGHPELEEVGRQIAAKCKGLPLALKTLAGMLRSKSEVEEWKRILRSEIWELPHNDILPALMLSYNDLPAHLKRCFSFCAIFPKDYPFRKEQVIHLWIANGLV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox