PRGDB00062276 (NBS-LRR disease resistance protein RGA6-like protein)

From PRG Wiki
Jump to: navigation, search
NBS-LRR disease resistance protein RGA6-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 226446434 (FJ826515)
Gene Class NL
Domain Type NBS, LRR
Gene Species Areca catechu

Comment?

Areca catechu NBS-LRR disease resistance protein RGA6-like protein gene, partial cds.

DNA Sequence

TGGAGGGGTGGGCAAAACAACTCTGGTCGACAAGGTGTATCGTAGCATGGAAAAGAAGTTTGAATGCGCTGGACAGATACCCATCTCGCAAACTTATAATAAGGCGGAGTTGGTTGGAAGAGTAAATGAGCTTTTATTTCGGAATGGAAGATATTTGATCGTGTTGGATGATGATGTATGGGATCTAACAGCTTTCAATGATATTAATGGTGCCCTTGTTGATTATAACAATGGAAGCAGAATAATCATTACAACCCGGAGTGCTGAGGTAGCTTCAGTAGCAGATGATGGTCGGCAGCTTAAGCTCGAAGGATTGGAAAGCACCGAGGCAAGGGCTCTGTTTTGCGACAGGGCATTCCGGAAAAATGAAGAGAGAAGATGTCCTCAAGAGCTGGAGGATTTGGTGCAGGATTTCTTATCGAGGTGTGGAGGCGTGCCACTAGCA


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein RGA6-like protein NBS-LRR disease resistance protein RGA6-like protein [Areca catechu].

GGVGKTTLVDKVYRSMEKKFECAGQIPISQTYNKAELVGRVNELLFRNGRYLIVLDDDVWDLTAFNDINGALVDYNNGSRIIITTRSAEVASVADDGRQLKLEGLESTEARALFCDRAFRKNEERRCPQELEDLVQDFLSRCGGVPLA


Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-148 SSF52540

GGVGKTTLVDKVYRSMEKKFECAGQIPISQTYNKAELVGRVNELLFRNGRYLIVLDDDVWDLTAFNDINGALVDYNNGSRIIITTRSAEVASVADDGRQLKLEGLESTEARALFCDRAFRKNEERRCPQELEDLVQDFLSRCGGVPLA

Gene3D: G3DSA:3.40.50.300
2-87 G3DSA:3.40.50.300

GVGKTTLVDKVYRSMEKKFECAGQIPISQTYNKAELVGRVNELLFRNGRYLIVLDDDVWDLTAFNDINGALVDYNNGSRIIITTRS

HMMPfam: PF00931
IPR002182
34-148 NB-ARC,NBS
NB-ARC

KAELVGRVNELLFRNGRYLIVLDDDVWDLTAFNDINGALVDYNNGSRIIITTRSAEVASVADDGRQLKLEGLESTEARALFCDRAFRKNEERRCPQELEDLVQDFLSRCGGVPLA

HMMPanther: PTHR11017:SF20
47-148 PTHR11017:SF20,SUBFAMILY NOT NAMED

RNGRYLIVLDDDVWDLTAFNDINGALVDYNNGSRIIITTRSAEVASVADDGRQLKLEGLESTEARALFCDRAFRKNEERRCPQELEDLVQDFLSRCGGVPLA

HMMPanther: PTHR11017
47-148 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RNGRYLIVLDDDVWDLTAFNDINGALVDYNNGSRIIITTRSAEVASVADDGRQLKLEGLESTEARALFCDRAFRKNEERRCPQELEDLVQDFLSRCGGVPLA

Gene3D: G3DSA:3.40.50.300
131-142 G3DSA:3.40.50.300

LEDLVQDFLSRC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox