PRGDB00062299 (Disease resistance protein RGA2, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RGA2, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 223539177 (EQ973879)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Ricinus communis

Comment?

Ricinus communis genomic scaffold scf_1106159300426, whole genome shotgun sequence.

DNA Sequence

ATGGTGGATGCAGTAGTCACTGTATTCTTAGAGAGGCTATTGAATACCTTAGTAGAGGAGGGGCGTGTGGTGAATGAATTTAGGGACCGATTTGAGAACTTGCAGAAGGAACTTGAATTAATGCAAAGTGTCCTTAAAGATGCAGACAAGCGAAAAAGGAAGGATGGAACTCTGCACACTATCATGGGCAATTTACGGGAACTGATTTATGAAGCTGAAGATATACTGGCAGATTGCCAACTTCAATCAAGGGAAGATGACAGGTTGTCTAATGGCTGGCTAACATGCATCCATCCGCCAAACCTTCATTTTCAATATAAAACTGGAAAGCGGCTGAGGGAGATTAATGAGAAAATCACTAAAATTAAGCAAGACATATCCTATCTTGATCTGTCGAACAGCAACCAAATGGGTAGAAGGGATGCACACAATGACCAGATGTCTCGTTGGAGCTCTCCTGTTTACGACCATACTCAAGTGGTCGGATTGGAAGGTGACACACAAAAGATAAAGAATTGGCTTTTTGAAGCAGATGATGGCATTTTAGCAATTGGTGTTGTTGGTATGGGTGGATTGGGAAAGACCACAATTGCTCAAAAGGTCTTTAATGACAGAGAAATAGATGATCACTTTGAAAGAAGAATGTGGATATCTGTCTCCCAGACACTTGATGAAGTGCAAATCATGAGAAGTATGCTGAGGAACTTGGGAGATGCAAGTATAGGAGATAACCAGGGTGAATTATTGAAGAAAATAAACCAATATCTTTTAGGTAAGAGATTCTTGATTGTTATGGATGATGTGTGGGGTTTGGATGTCAATTGGTGGCGCAGAATCTATGAAGGCTTGCCTAAGGGAAATGGAAGCAGCATTATCATTACTACAAGGATTGAGGAAGTTGCAAGAAAGATGGGTGTCACTGAAGTGCGTATCCACCGGCCAAAGTTCCTTAGCAAGGATGATAGTTGGTTGCTATTTAGGAAGATTGCTTTTGCAGCAACTGGAGGTGAATGCAGGCATCCTGAGCTGGAAAATGTTGGAACAGAGATTGTACAGAAATGTAAGGGTCTTCCCCTGGCCATTAAGGCAATTGGAGGCCTATTGCTTTACAAATCGCATTATCATGAGTGGAGGCAGATCGCAGGCAACTTTCGAGACGAATTGGCAGAAAATGATGACTCTGTGATGGCATCGTTACAATTGAGCTATGATGAGTTGCCGCCATATCTGAAGTCATGTTTTCTCAGTTTCTCTCTTTACCCAGAGGATTGCGTTATAAAGAAAGAGCAGTTGGTTCATTGGTGGATTGGAGAGGGGTTTGTCCCATTGAGAATTGGTAGATCATCAACTGAAGCTGGGGAAGGTTGTTTCTCAGGGTTAACAAATCGATGTTTGGTGGAAGTTGTTGACAAGACTTACAATGGAACTATTGCCACTTGCAAGATTCATGATATGGTTCGTGATTTGGTAATCAAGATGGCTGGAGATGATGCATTCTTTAAACTTAACGGTATAGGCTGCCGTCATCTAGCAATTTGTAGTAATATGGATCAGAAGAAACTTACTGCCAATCAAAAGTTACGGGCATTGTTGTCCACAACCAAGACTGGTGAAGTTAACCGAATTGTATCAAGCATTGCAAACAAGTTTAGCGAGTGCAAATACTTGAGAGTTTTGGATCTTTGCAAATCAATCTTTGAAGTGCCTCTCACAAATCTACTATATCAGATTGGGGATCTTCAACACTTAACATATCTTAGCTTAAGCAATACCCATCCTTTGATTGAACTCCCACCTTCTCTAGAGAAGCTTAAAAACCTTCAGATTTTGGATATGAGCTATTGCCAAAATTTGAAAATGCTGCCGCCTTATCTCATAACCTTTAAGAAGCTCAGAGTCTTAGATGTAAGCCACTGTGGTTCACTTGAATACTTGCCAAAAGGCTTGGGAAGGCTTTCAAATCTTGAAGTTCTGATGGGATTTAGACCTTCTAGATTAGGTCAATTAGGCGGCTGTCGGATTGCTGAACTCAGAAATTTGACCCGACTGAGGACTCTAAGCTTACATCTGACACAGGGTGATGAGATTGAAGATAATGAAGTTAATGCGTTGGTGAATCTCCAGGAACTTGAACACCTGACTATAAGTTGCTTTGATAGCCAAGGTAATGACCTTATTGGAAAACTTGATAGACTCTATCCTCCACCAGAAATCTATGAGCTTTCACTCGCATTTTATCCGGGCAAGATGAGTCCTGTCTGGCTCAATCCTATCTCACTTCCTATGTTAAGATATCTTTCAATCTCTTCGGGGAATCTTGCGCAGATGCATCAAAGCTTTTGGGGGGAGGATAACAGTGTGTGGAAAATTGAGGCCTTGCTGCTGGAATCTCTCTCAGAATTGGGCATGGACTGGTCAATGATACAAAATGTGATGCCATCTTTGAGGATTGTGAACTCTAGTTGGTGTCCTGATTTATCAGCTTTTCCTATTGAGGAAATTGGATTTAGAGGGGGTGTATGGACAAAGGAAGAGCAGAGGAACTGA


Protein sequences

Name Description Sequence
Disease resistance protein RGA2, putative Disease resistance protein RGA2, putative [Ricinus communis].

MVDAVVTVFLERLLNTLVEEGRVVNEFRDRFENLQKELELMQSVLKDADKRKRKDGTLHTIMGNLRELIYEAEDILADCQLQSREDDRLSNGWLTCIHPPNLHFQYKTGKRLREINEKITKIKQDISYLDLSNSNQMGRRDAHNDQMSRWSSPVYDHTQVVGLEGDTQKIKNWLFEADDGILAIGVVGMGGLGKTTIAQKVFNDREIDDHFERRMWISVSQTLDEVQIMRSMLRNLGDASIGDNQGELLKKINQYLLGKRFLIVMDDVWGLDVNWWRRIYEGLPKGNGSSIIITTRIEEVARKMGVTEVRIHRPKFLSKDDSWLLFRKIAFAATGGECRHPELENVGTEIVQKCKGLPLAIKAIGGLLLYKSHYHEWRQIAGNFRDELAENDDSVMASLQLSYDELPPYLKSCFLSFSLYPEDCVIKKEQLVHWWIGEGFVPLRIGRSSTEAGEGCFSGLTNRCLVEVVDKTYNGTIATCKIHDMVRDLVIKMAGDDAFFKLNGIGCRHLAICSNMDQKKLTANQKLRALLSTTKTGEVNRIVSSIANKFSECKYLRVLDLCKSIFEVPLTNLLYQIGDLQHLTYLSLSNTHPLIELPPSLEKLKNLQILDMSYCQNLKMLPPYLITFKKLRVLDVSHCGSLEYLPKGLGRLSNLEVLMGFRPSRLGQLGGCRIAELRNLTRLRTLSLHLTQGDEIEDNEVNALVNLQELEHLTISCFDSQGNDLIGKLDRLYPPPEIYELSLAFYPGKMSPVWLNPISLPMLRYLSISSGNLAQMHQSFWGEDNSVWKIEALLLESLSELGMDWSMIQNVMPSLRIVNSSWCPDLSAFPIEEIGFRGGVWTKEEQRN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF244
2-843 PTHR23155:SF244,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

VDAVVTVFLERLLNTLVEEGRVVNEFRDRFENLQKELELMQSVLKDADKRKRKDGTLHTIMGNLRELIYEAEDILADCQLQSREDDRLSNGWLTCIHPPNLHFQYKTGKRLREINEKITKIKQDISYLDLSNSNQMGRRDAHNDQMSRWSSPVYDHTQVVGLEGDTQKIKNWLFEADDGILAIGVVGMGGLGKTTIAQKVFNDREIDDHFERRMWISVSQTLDEVQIMRSMLRNLGDASIGDNQGELLKKINQYLLGKRFLIVMDDVWGLDVNWWRRIYEGLPKGNGSSIIITTRIEEVARKMGVTEVRIHRPKFLSKDDSWLLFRKIAFAATGGECRHPELENVGTEIVQKCKGLPLAIKAIGGLLLYKSHYHEWRQIAGNFRDELAENDDSVMASLQLSYDELPPYLKSCFLSFSLYPEDCVIKKEQLVHWWIGEGFVPLRIGRSSTEAGEGCFSGLTNRCLVEVVDKTYNGTIATCKIHDMVRDLVIKMAGDDAFFKLNGIGCRHLAICSNMDQKKLTANQKLRALLSTTKTGEVNRIVSSIANKFSECKYLRVLDLCKSIFEVPLTNLLYQIGDLQHLTYLSLSNTHPLIELPPSLEKLKNLQILDMSYCQNLKMLPPYLITFKKLRVLDVSHCGSLEYLPKGLGRLSNLEVLMGFRPSRLGQLGGCRIAELRNLTRLRTLSLHLTQGDEIEDNEVNALVNLQELEHLTISCFDSQGNDLIGKLDRLYPPPEIYELSLAFYPGKMSPVWLNPISLPMLRYLSISSGNLAQMHQSFWGEDNSVWKIEALLLESLSELGMDWSMIQNVMPSLRIVNSSWCPDLSAFPIEEIGFRGGVWTK

HMMPanther: PTHR23155
2-843 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VDAVVTVFLERLLNTLVEEGRVVNEFRDRFENLQKELELMQSVLKDADKRKRKDGTLHTIMGNLRELIYEAEDILADCQLQSREDDRLSNGWLTCIHPPNLHFQYKTGKRLREINEKITKIKQDISYLDLSNSNQMGRRDAHNDQMSRWSSPVYDHTQVVGLEGDTQKIKNWLFEADDGILAIGVVGMGGLGKTTIAQKVFNDREIDDHFERRMWISVSQTLDEVQIMRSMLRNLGDASIGDNQGELLKKINQYLLGKRFLIVMDDVWGLDVNWWRRIYEGLPKGNGSSIIITTRIEEVARKMGVTEVRIHRPKFLSKDDSWLLFRKIAFAATGGECRHPELENVGTEIVQKCKGLPLAIKAIGGLLLYKSHYHEWRQIAGNFRDELAENDDSVMASLQLSYDELPPYLKSCFLSFSLYPEDCVIKKEQLVHWWIGEGFVPLRIGRSSTEAGEGCFSGLTNRCLVEVVDKTYNGTIATCKIHDMVRDLVIKMAGDDAFFKLNGIGCRHLAICSNMDQKKLTANQKLRALLSTTKTGEVNRIVSSIANKFSECKYLRVLDLCKSIFEVPLTNLLYQIGDLQHLTYLSLSNTHPLIELPPSLEKLKNLQILDMSYCQNLKMLPPYLITFKKLRVLDVSHCGSLEYLPKGLGRLSNLEVLMGFRPSRLGQLGGCRIAELRNLTRLRTLSLHLTQGDEIEDNEVNALVNLQELEHLTISCFDSQGNDLIGKLDRLYPPPEIYELSLAFYPGKMSPVWLNPISLPMLRYLSISSGNLAQMHQSFWGEDNSVWKIEALLLESLSELGMDWSMIQNVMPSLRIVNSSWCPDLSAFPIEEIGFRGGVWTK

Gene3D: G3DSA:3.80.10.10
98-139 G3DSA:3.80.10.10

HPPNLHFQYKTGKRLREINEKITKIKQDISYLDLSNSNQMGR

superfamily: SSF52540
143-391 SSF52540

HNDQMSRWSSPVYDHTQVVGLEGDTQKIKNWLFEADDGILAIGVVGMGGLGKTTIAQKVFNDREIDDHFERRMWISVSQTLDEVQIMRSMLRNLGDASIGDNQGELLKKINQYLLGKRFLIVMDDVWGLDVNWWRRIYEGLPKGNGSSIIITTRIEEVARKMGVTEVRIHRPKFLSKDDSWLLFRKIAFAATGGECRHPELENVGTEIVQKCKGLPLAIKAIGGLLLYKSHYHEWRQIAGNFRDELAEN

HMMPfam: PF00931
IPR002182
166-442 NB-ARC,NBS
NB-ARC

DTQKIKNWLFEADDGILAIGVVGMGGLGKTTIAQKVFNDREIDDHFERRMWISVSQTLDEVQIMRSMLRNLGDASIGDNQGELLKKINQYLLGKRFLIVMDDVWGLDVNWWRRIYEGLPKGNGSSIIITTRIEEVARKMGVTEVRIHRPKFLSKDDSWLLFRKIAFAATGGECRHPELENVGTEIVQKCKGLPLAIKAIGGLLLYKSHYHEWRQIAGNFRDELAENDDSVMASLQLSYDELPPYLKSCFLSFSLYPEDCVIKKEQLVHWWIGEGFVP

Gene3D: G3DSA:3.40.50.300
169-297 G3DSA:3.40.50.300

KIKNWLFEADDGILAIGVVGMGGLGKTTIAQKVFNDREIDDHFERRMWISVSQTLDEVQIMRSMLRNLGDASIGDNQGELLKKINQYLLGKRFLIVMDDVWGLDVNWWRRIYEGLPKGNGSSIIITTRI

FPrintScan: PR00364
IPR000767
183-198 DISEASERSIST
Disease resistance protein

AIGVVGMGGLGKTTIA

FPrintScan: PR00364
IPR000767
255-269 DISEASERSIST
Disease resistance protein

YLLGKRFLIVMDDVW

FPrintScan: PR00364
IPR000767
354-368 DISEASERSIST
Disease resistance protein

CKGLPLAIKAIGGLL

superfamily: SSF52058
478-835 SSF52058,LRR

ATCKIHDMVRDLVIKMAGDDAFFKLNGIGCRHLAICSNMDQKKLTANQKLRALLSTTKTGEVNRIVSSIANKFSECKYLRVLDLCKSIFEVPLTNLLYQIGDLQHLTYLSLSNTHPLIELPPSLEKLKNLQILDMSYCQNLKMLPPYLITFKKLRVLDVSHCGSLEYLPKGLGRLSNLEVLMGFRPSRLGQLGGCRIAELRNLTRLRTLSLHLTQGDEIEDNEVNALVNLQELEHLTISCFDSQGNDLIGKLDRLYPPPEIYELSLAFYPGKMSPVWLNPISLPMLRYLSISSGNLAQMHQSFWGEDNSVWKIEALLLESLSELGMDWSMIQNVMPSLRIVNSSWCPDLSAFPIEEIG

Gene3D: G3DSA:3.80.10.10
548-818 G3DSA:3.80.10.10

NKFSECKYLRVLDLCKSIFEVPLTNLLYQIGDLQHLTYLSLSNTHPLIELPPSLEKLKNLQILDMSYCQNLKMLPPYLITFKKLRVLDVSHCGSLEYLPKGLGRLSNLEVLMGFRPSRLGQLGGCRIAELRNLTRLRTLSLHLTQGDEIEDNEVNALVNLQELEHLTISCFDSQGNDLIGKLDRLYPPPEIYELSLAFYPGKMSPVWLNPISLPMLRYLSISSGNLAQMHQSFWGEDNSVWKIEALLLESLSELGMDWSMIQNVMPSLRIV

HMMPfam: PF00560
IPR001611
582-604 LRR_1
Leucine-rich repeat

HLTYLSLSNTHPLIELPPSLEKL

FPrintScan: PR00364
IPR000767
602-618 DISEASERSIST
Disease resistance protein

EKLKNLQILDMSYCQNL

HMMPfam: PF00560
IPR001611
606-624 LRR_1
Leucine-rich repeat

NLQILDMSYCQNLKMLPPY

HMMPfam: PF00560
IPR001611
630-652 LRR_1
Leucine-rich repeat

KLRVLDVSHCGSLEYLPKGLGRL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox