PRGDB00062313 (Disease resistance protein RGA2, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RGA2, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 223533882 (EQ974013)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Ricinus communis

Comment?

Ricinus communis genomic scaffold scf_1106159291084, whole genome shotgun sequence.

DNA Sequence

ATGGCAGAATCAATCTTGTTTACCATTGTAGCAGAGATTATTGTAAAATTGGGTTCGCGACCATTTCAAGCAAATACCATGTGGATTGGTGTCAAAGATGAGCTTGAAAAATTCAAGACAACAGTGTCAACGATCCAAGCTGTGCTTCTTGATGCTGAGGAGCAGTACTCAAAAAGTAATCAAGTCAGAGTTTGGGTTGATTCACTGAAGGAAGTGTTTTATGATGCTGAGGACTTGTTGGATGAACTTTCTACAGAAGTTCTGCAGCAACAAACGGTGACTGGTAATAAGATGGCTAAGGAGGTACGTCGTTTTTTTTCTAGTTCAAACCAGGTTGCTTTTGGTCTTAAAATGACTCATAAGATTAAGGCTGTTAGAGATAGACTTGATGTGATTGTAGCTAATAGGAAGTTTCATTTAGAGGAGCGTAGAGTAGAGGCCAATCATGTGATCATGTCTAGGGAAAGAGAGCAAACTCACTCCTCTCCACCAGAAGTTATTGTTGGGAGAGAAGAAGATAAACAAGCAATTATAGAGTTGTTGATGGCTTCTAATTATGAAGAGAATGTGGTAGTGATTCCAATAGTTGGTATTGGAGGGTTAGGAAAGACCACTTTGGCTCAACTTGTGTACAATGATGAGAGGGTTAAAACCCATTTCAAGTCAAGTAGTTGGGTTTGTGTTTCTGATGATTTTGATGTGAAAATAATAGTTCAAAAAATTTTGGAGTCTGTTACTGGTGATAGATGTTTTAGTTTTGAGATGGATACTCTGAAAAATCGTCTTCATGAGACAATTAATGGGAAAAGATTTTTGCTTGTTTTAGATGATATATGGTGTGATAATTTTGAGACATGGTGTCGTTTGAGAGATTTGTTAGTCGGTGGTGCTAGAGGAAGTAGAATAATCATAACCACTAGAATTAAGAAGGTTGCGGAGATAGTTAGCACAAATCAGCCATATGAGTTAGAAGGCCTTTCTGACATGGACTCTTGGTCTTTGTTCAAACTAATGGCATTTAAACAAGGGAAGGTGCCAAGTCCTAGTTTTGATGCTATCGGGAGGGAGATTGTGGGGAAATATGTTGGAGTTCCCCTGGCCATTAGAGCAATAGGACGCTTATTGTATTTCAAGAATGCATCTGAGTGGCTATCCTTCAAAAATAAGGAGCTCTCGAATGTGGATCTGAAAGAGAATGACATTTTGTCCACTTTGAAGTTGAGTTATGATCATCTCCCCCCACGTTTGAGACATTGCTTTGCTTATTGTAGAATATTTCCAAAAGGGTCTAAGATTAATGTCAAGAAATTGGTTTATCTTTGGATGGCACAAGGATATATCAAGTCGTCCGATCCAAGTCAATGTCTTGAAGATGTTGGCTTTGAATATTTTAATGATCTTCTTTGGAGGTCTTTTTTCCAAGAAGTAGAGAAGGATCATTTTGGAAATATTAATATATGTAGAATACATGATCTTATGCATGATCTTTGTTGGTCAGTGGTTGGTTCAGGAAGTAATTTATCATCTTCAAATGTGAAATATGTCAGTAAAGGAACTCGACATGTATCGATTGATTATTGTAAGGGAGCTATGCTTCCCAGTTTGCTAGATGTAAGAAAAATGCGGACTTTTTTCTTGTCAAATGAACCGGGGTATAATGGAAATAAAAACCAAGGCCTTGAAATCATTTCCAATTTAAGGAGAGTAAGGGCATTAGATGCACACAATTCTGGAATTGTGATGGTTCCTCGTTCCCTTGAGAAGTTGAAGCATATAAGATTTCTTGATCTTTCATACAATACACGAATTGAGACACTTCCTGATTCCATAACTAAACTGCAAAACCTGCAAGTGCTCAAACTAGCAGGATTGAGAAGGCTGAAGCAACTGCCTAAGGACATCAAGAAGTTGGTGGATCTGATGCATCTTGACCTTTGGAAATGTGATGGTTTGACTCACATGCCCCCTGGGCTTGGTCAATTGACTTCCCTTAGCTACTTGTCGAGATTCCTAGTGGCCAAAGATGATGGCGTCTCCAAGCATGTTAGTGGACTTGGCGAGTTATGCGATTTGAATAATTTGAGAGGATTGCTAGAAATCATGAATCTGCAGAATGTGAAAAATCCAGCATCAGAGTTTAGGACAGCTAATCTGAAAGAGAAGCAGCACCTTCAAACATTGAAACTGACATGGAAATCAGGTGATGAGGATGATAATACTGCAAGTGGTTCAAATGATGACGTGTCATTGGAAGAGCTACAGCCACACGAGAATCTCCAATGGCTAGACGTGCGTGGGTGGGGAAGATTGAGGTTTCCAAGCTGGGTTGCTTCACTCACTAGTTTGGTGGAACTTCGAATTGATAACTGCATAAACTGCCAAAATCTCCCACCTCTAGATCAGTTCCCTTCTCTTAAACATTTGACACTTGATAAATTAAATGATTTGAAGTACATTGAGAGTGGGATAACTTATGATCGTGCAGAGTCAGGACCGGCATTATTTTTCCCTTCCCTAGAGAAGCTATGGCTCAGAAATTGTCCTAATCTGAAGGGATGGTGTAGGACTGATACATCAGCGCCTGAGTTATTCCAGTTTCATTGTCTTGCTTATTTTGAAATCAAGTCTTGTCCTAATTTGACTTCAATGCCACTGATTCCAACTGTGGAAAGGATGGTATTTCAAAATACCAGCATCAAGTCGATGAAGGACATGTTAAAGTTGAAACTTTTGCTGCCACAATCTGCCTCTTCTTCTTGTTCTTCTTCTTCTCTGTCTCCTTCTCTCGTACAATTGAAAGAATTGAGTATTCAGAAAATAGAGGATCTAGACTTTCTACCAGATGAGTTGCTGCAAAATCTCACTTCCCTGCAACAGCTGGATATCATAGATTGTCCAAGAATAACCACTCTATCTCATGATATGCAACATTTGACCTCTCTTGAGGTTCTTATCATCAGGGCTTGTAAGGAGCTAGATTTATCATCAGAGCAGTGGCAGTGCCTCAGAAGCCTCAGGAAGCTTCGCATTGTAAATCTAGCGAAGTTGGTGTCACTGCATCAAGGCCTTCAACATGTTACCACTTTGCAACAACTCGAAATCTGTAGTTGTCCCATTTTGGGGACTTTACCCGAGTGGATCAGTGGCCTCACGACATTGCGACATTTGGAGATCAATGAATGTCCTCTTCTTTCACAGAAATGCAGTAACAATAAGGGAGAGGATTGGTCCAAGATTGCTCATATTCCAAATATCAAAATTGATGGGAGATGGATTCAATTGAAGGGCTACTACGAACTGTGA


Protein sequences

Name Description Sequence
Disease resistance protein RGA2, putative Disease resistance protein RGA2, putative [Ricinus communis].

MAESILFTIVAEIIVKLGSRPFQANTMWIGVKDELEKFKTTVSTIQAVLLDAEEQYSKSNQVRVWVDSLKEVFYDAEDLLDELSTEVLQQQTVTGNKMAKEVRRFFSSSNQVAFGLKMTHKIKAVRDRLDVIVANRKFHLEERRVEANHVIMSREREQTHSSPPEVIVGREEDKQAIIELLMASNYEENVVVIPIVGIGGLGKTTLAQLVYNDERVKTHFKSSSWVCVSDDFDVKIIVQKILESVTGDRCFSFEMDTLKNRLHETINGKRFLLVLDDIWCDNFETWCRLRDLLVGGARGSRIIITTRIKKVAEIVSTNQPYELEGLSDMDSWSLFKLMAFKQGKVPSPSFDAIGREIVGKYVGVPLAIRAIGRLLYFKNASEWLSFKNKELSNVDLKENDILSTLKLSYDHLPPRLRHCFAYCRIFPKGSKINVKKLVYLWMAQGYIKSSDPSQCLEDVGFEYFNDLLWRSFFQEVEKDHFGNINICRIHDLMHDLCWSVVGSGSNLSSSNVKYVSKGTRHVSIDYCKGAMLPSLLDVRKMRTFFLSNEPGYNGNKNQGLEIISNLRRVRALDAHNSGIVMVPRSLEKLKHIRFLDLSYNTRIETLPDSITKLQNLQVLKLAGLRRLKQLPKDIKKLVDLMHLDLWKCDGLTHMPPGLGQLTSLSYLSRFLVAKDDGVSKHVSGLGELCDLNNLRGLLEIMNLQNVKNPASEFRTANLKEKQHLQTLKLTWKSGDEDDNTASGSNDDVSLEELQPHENLQWLDVRGWGRLRFPSWVASLTSLVELRIDNCINCQNLPPLDQFPSLKHLTLDKLNDLKYIESGITYDRAESGPALFFPSLEKLWLRNCPNLKGWCRTDTSAPELFQFHCLAYFEIKSCPNLTSMPLIPTVERMVFQNTSIKSMKDMLKLKLLLPQSASSSCSSSSLSPSLVQLKELSIQKIEDLDFLPDELLQNLTSLQQLDIIDCPRITTLSHDMQHLTSLEVLIIRACKELDLSSEQWQCLRSLRKLRIVNLAKLVSLHQGLQHVTTLQQLEICSCPILGTLPEWISGLTTLRHLEINECPLLSQKCSNNKGEDWSKIAHIPNIKIDGRWIQLKGYYEL

Disease resistance protein RGA2, putative Disease resistance protein RGA2, putative [Ricinus communis].

MAESILFTIVAEIIVKLGSRPFQANTMWIGVKDELEKFKTTVSTIQAVLLDAEEQYSKSNQVRVWVDSLKEVFYDAEDLLDELSTEVLQQQTVTGNKMAKEVRRFFSSSNQVAFGLKMTHKIKAVRDRLDVIVANRKFHLEERRVEANHVIMSREREQTHSSPPEVIVGREEDKQAIIELLMASNYEENVVVIPIVGIGGLGKTTLAQLVYNDERVKTHFKSSSWVCVSDDFDVKIIVQKILESVTGDRCFSFEMDTLKNRLHETINGKRFLLVLDDIWCDNFETWCRLRDLLVGGARGSRIIITTRIKKVAEIVSTNQPYELEGLSDMDSWSLFKLMAFKQGKVPSPSFDAIGREIVGKYVGVPLAIRAIGRLLYFKNASEWLSFKNKELSNVDLKENDILSTLKLSYDHLPPRLRHCFAYCRIFPKGSKINVKKLVYLWMAQGYIKSSDPSQCLEDVGFEYFNDLLWRSFFQEVEKDHFGNINICRIHDLMHDLCWSVVGSGSNLSSSNVKYVSKGTRHVSIDYCKGAMLPSLLDVRKMRTFFLSNEPGYNGNKNQGLEIISNLRRVRALDAHNSGIVMVPRSLEKLKHIRFLDLSYNTRIETLPDSITKLQNLQVLKLAGLRRLKQLPKDIKKLVDLMHLDLWKCDGLTHMPPGLGQLTSLSYLSRFLVAKDDGVSKHVSGLGELCDLNNLRGLLEIMNLQNVKNPASEFRTANLKEKQHLQTLKLTWKSGDEDDNTASGSNDDVSLEELQPHENLQWLDVRGWGRLRFPSWVASLTSLVELRIDNCINCQNLPPLDQFPSLKHLTLDKLNDLKYIESGITYDRAESGPALFFPSLEKLWLRNCPNLKGWCRTDTSAPELFQFHCLAYFEIKSCPNLTSMPLIPTVERMVFQNTSIKSMKDMLKLKLLLPQSASSSCSSSSLSPSLVQLKELSIQKIEDLDFLPDELLQNLTSLQQLDIIDCPRITTLSHDMQHLTSLEVLIIRACKELDLSSEQWQCLRSLRKLRIVNLAKLVSLHQGLQHVTTLQQLEICSCPILGTLPEWISGLTTLRHLEINECPLLSQKCSNNKGEDWSKIAHIPNIKIDGRWIQLKGYYEL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
44-1072 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TIQAVLLDAEEQYSKSNQVRVWVDSLKEVFYDAEDLLDELSTEVLQQQTVTGNKMAKEVRRFFSSSNQVAFGLKMTHKIKAVRDRLDVIVANRKFHLEERRVEANHVIMSREREQTHSSPPEVIVGREEDKQAIIELLMASNYEENVVVIPIVGIGGLGKTTLAQLVYNDERVKTHFKSSSWVCVSDDFDVKIIVQKILESVTGDRCFSFEMDTLKNRLHETINGKRFLLVLDDIWCDNFETWCRLRDLLVGGARGSRIIITTRIKKVAEIVSTNQPYELEGLSDMDSWSLFKLMAFKQGKVPSPSFDAIGREIVGKYVGVPLAIRAIGRLLYFKNASEWLSFKNKELSNVDLKENDILSTLKLSYDHLPPRLRHCFAYCRIFPKGSKINVKKLVYLWMAQGYIKSSDPSQCLEDVGFEYFNDLLWRSFFQEVEKDHFGNINICRIHDLMHDLCWSVVGSGSNLSSSNVKYVSKGTRHVSIDYCKGAMLPSLLDVRKMRTFFLSNEPGYNGNKNQGLEIISNLRRVRALDAHNSGIVMVPRSLEKLKHIRFLDLSYNTRIETLPDSITKLQNLQVLKLAGLRRLKQLPKDIKKLVDLMHLDLWKCDGLTHMPPGLGQLTSLSYLSRFLVAKDDGVSKHVSGLGELCDLNNLRGLLEIMNLQNVKNPASEFRTANLKEKQHLQTLKLTWKSGDEDDNTASGSNDDVSLEELQPHENLQWLDVRGWGRLRFPSWVASLTSLVELRIDNCINCQNLPPLDQFPSLKHLTLDKLNDLKYIESGITYDRAESGPALFFPSLEKLWLRNCPNLKGWCRTDTSAPELFQFHCLAYFEIKSCPNLTSMPLIPTVERMVFQNTSIKSMKDMLKLKLLLPQSASSSCSSSSLSPSLVQLKELSIQKIEDLDFLPDELLQNLTSLQQLDIIDCPRITTLSHDMQHLTSLEVLIIRACKELDLSSEQWQCLRSLRKLRIVNLAKLVSLHQGLQHVTTLQQLEICSCPILGTLPEWISGLTTLRHLEINECPLLSQKCSNNK

HMMPanther: PTHR23155
44-1072 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TIQAVLLDAEEQYSKSNQVRVWVDSLKEVFYDAEDLLDELSTEVLQQQTVTGNKMAKEVRRFFSSSNQVAFGLKMTHKIKAVRDRLDVIVANRKFHLEERRVEANHVIMSREREQTHSSPPEVIVGREEDKQAIIELLMASNYEENVVVIPIVGIGGLGKTTLAQLVYNDERVKTHFKSSSWVCVSDDFDVKIIVQKILESVTGDRCFSFEMDTLKNRLHETINGKRFLLVLDDIWCDNFETWCRLRDLLVGGARGSRIIITTRIKKVAEIVSTNQPYELEGLSDMDSWSLFKLMAFKQGKVPSPSFDAIGREIVGKYVGVPLAIRAIGRLLYFKNASEWLSFKNKELSNVDLKENDILSTLKLSYDHLPPRLRHCFAYCRIFPKGSKINVKKLVYLWMAQGYIKSSDPSQCLEDVGFEYFNDLLWRSFFQEVEKDHFGNINICRIHDLMHDLCWSVVGSGSNLSSSNVKYVSKGTRHVSIDYCKGAMLPSLLDVRKMRTFFLSNEPGYNGNKNQGLEIISNLRRVRALDAHNSGIVMVPRSLEKLKHIRFLDLSYNTRIETLPDSITKLQNLQVLKLAGLRRLKQLPKDIKKLVDLMHLDLWKCDGLTHMPPGLGQLTSLSYLSRFLVAKDDGVSKHVSGLGELCDLNNLRGLLEIMNLQNVKNPASEFRTANLKEKQHLQTLKLTWKSGDEDDNTASGSNDDVSLEELQPHENLQWLDVRGWGRLRFPSWVASLTSLVELRIDNCINCQNLPPLDQFPSLKHLTLDKLNDLKYIESGITYDRAESGPALFFPSLEKLWLRNCPNLKGWCRTDTSAPELFQFHCLAYFEIKSCPNLTSMPLIPTVERMVFQNTSIKSMKDMLKLKLLLPQSASSSCSSSSLSPSLVQLKELSIQKIEDLDFLPDELLQNLTSLQQLDIIDCPRITTLSHDMQHLTSLEVLIIRACKELDLSSEQWQCLRSLRKLRIVNLAKLVSLHQGLQHVTTLQQLEICSCPILGTLPEWISGLTTLRHLEINECPLLSQKCSNNK

superfamily: SSF52540
150-394 SSF52540

VIMSREREQTHSSPPEVIVGREEDKQAIIELLMASNYEENVVVIPIVGIGGLGKTTLAQLVYNDERVKTHFKSSSWVCVSDDFDVKIIVQKILESVTGDRCFSFEMDTLKNRLHETINGKRFLLVLDDIWCDNFETWCRLRDLLVGGARGSRIIITTRIKKVAEIVSTNQPYELEGLSDMDSWSLFKLMAFKQGKVPSPSFDAIGREIVGKYVGVPLAIRAIGRLLYFKNASEWLSFKNKELSNV

superfamily: SSF52540
150-394 SSF52540

VIMSREREQTHSSPPEVIVGREEDKQAIIELLMASNYEENVVVIPIVGIGGLGKTTLAQLVYNDERVKTHFKSSSWVCVSDDFDVKIIVQKILESVTGDRCFSFEMDTLKNRLHETINGKRFLLVLDDIWCDNFETWCRLRDLLVGGARGSRIIITTRIKKVAEIVSTNQPYELEGLSDMDSWSLFKLMAFKQGKVPSPSFDAIGREIVGKYVGVPLAIRAIGRLLYFKNASEWLSFKNKELSNV

Gene3D: G3DSA:3.40.50.300
168-279 G3DSA:3.40.50.300

VGREEDKQAIIELLMASNYEENVVVIPIVGIGGLGKTTLAQLVYNDERVKTHFKSSSWVCVSDDFDVKIIVQKILESVTGDRCFSFEMDTLKNRLHETINGKRFLLVLDDIW

Gene3D: G3DSA:3.40.50.300
168-279 G3DSA:3.40.50.300

VGREEDKQAIIELLMASNYEENVVVIPIVGIGGLGKTTLAQLVYNDERVKTHFKSSSWVCVSDDFDVKIIVQKILESVTGDRCFSFEMDTLKNRLHETINGKRFLLVLDDIW

HMMPfam: PF00931
IPR002182
170-451 NB-ARC,NBS
NB-ARC

REEDKQAIIELLMASNYEENVVVIPIVGIGGLGKTTLAQLVYNDERVKTHFKSSSWVCVSDDFDVKIIVQKILESVTGDRCFSFEMDTLKNRLHETINGKRFLLVLDDIWCDNFETWCRLRDLLVGGARGSRIIITTRIKKVAEIVSTNQPYELEGLSDMDSWSLFKLMAFKQGKVPSPSFDAIGREIVGKYVGVPLAIRAIGRLLYFKNASEWLSFKNKELSNVDLKENDILSTLKLSYDHLPPRLRHCFAYCRIFPKGSKINVKKLVYLWMAQGYIKSSD

HMMPfam: PF00931
IPR002182
170-451 NB-ARC,NBS
NB-ARC

REEDKQAIIELLMASNYEENVVVIPIVGIGGLGKTTLAQLVYNDERVKTHFKSSSWVCVSDDFDVKIIVQKILESVTGDRCFSFEMDTLKNRLHETINGKRFLLVLDDIWCDNFETWCRLRDLLVGGARGSRIIITTRIKKVAEIVSTNQPYELEGLSDMDSWSLFKLMAFKQGKVPSPSFDAIGREIVGKYVGVPLAIRAIGRLLYFKNASEWLSFKNKELSNVDLKENDILSTLKLSYDHLPPRLRHCFAYCRIFPKGSKINVKKLVYLWMAQGYIKSSD

FPrintScan: PR00364
IPR000767
192-207 DISEASERSIST
Disease resistance protein

VIPIVGIGGLGKTTLA

FPrintScan: PR00364
IPR000767
192-207 DISEASERSIST
Disease resistance protein

VIPIVGIGGLGKTTLA

FPrintScan: PR00364
IPR000767
265-279 DISEASERSIST
Disease resistance protein

TINGKRFLLVLDDIW

FPrintScan: PR00364
IPR000767
265-279 DISEASERSIST
Disease resistance protein

TINGKRFLLVLDDIW

FPrintScan: PR00364
IPR000767
361-375 DISEASERSIST
Disease resistance protein

YVGVPLAIRAIGRLL

FPrintScan: PR00364
IPR000767
361-375 DISEASERSIST
Disease resistance protein

YVGVPLAIRAIGRLL

Gene3D: G3DSA:3.80.10.10
384-412 G3DSA:3.80.10.10

LSFKNKELSNVDLKENDILSTLKLSYDHL

Gene3D: G3DSA:3.80.10.10
384-412 G3DSA:3.80.10.10

LSFKNKELSNVDLKENDILSTLKLSYDHL

superfamily: SSF52058
488-884 SSF52058,LRR

RIHDLMHDLCWSVVGSGSNLSSSNVKYVSKGTRHVSIDYCKGAMLPSLLDVRKMRTFFLSNEPGYNGNKNQGLEIISNLRRVRALDAHNSGIVMVPRSLEKLKHIRFLDLSYNTRIETLPDSITKLQNLQVLKLAGLRRLKQLPKDIKKLVDLMHLDLWKCDGLTHMPPGLGQLTSLSYLSRFLVAKDDGVSKHVSGLGELCDLNNLRGLLEIMNLQNVKNPASEFRTANLKEKQHLQTLKLTWKSGDEDDNTASGSNDDVSLEELQPHENLQWLDVRGWGRLRFPSWVASLTSLVELRIDNCINCQNLPPLDQFPSLKHLTLDKLNDLKYIESGITYDRAESGPALFFPSLEKLWLRNCPNLKGWCRTDTSAPELFQFHCLAYFEIKSCPNLTSMP

superfamily: SSF52058
488-884 SSF52058,LRR

RIHDLMHDLCWSVVGSGSNLSSSNVKYVSKGTRHVSIDYCKGAMLPSLLDVRKMRTFFLSNEPGYNGNKNQGLEIISNLRRVRALDAHNSGIVMVPRSLEKLKHIRFLDLSYNTRIETLPDSITKLQNLQVLKLAGLRRLKQLPKDIKKLVDLMHLDLWKCDGLTHMPPGLGQLTSLSYLSRFLVAKDDGVSKHVSGLGELCDLNNLRGLLEIMNLQNVKNPASEFRTANLKEKQHLQTLKLTWKSGDEDDNTASGSNDDVSLEELQPHENLQWLDVRGWGRLRFPSWVASLTSLVELRIDNCINCQNLPPLDQFPSLKHLTLDKLNDLKYIESGITYDRAESGPALFFPSLEKLWLRNCPNLKGWCRTDTSAPELFQFHCLAYFEIKSCPNLTSMP

Gene3D: G3DSA:3.80.10.10
530-668 G3DSA:3.80.10.10

AMLPSLLDVRKMRTFFLSNEPGYNGNKNQGLEIISNLRRVRALDAHNSGIVMVPRSLEKLKHIRFLDLSYNTRIETLPDSITKLQNLQVLKLAGLRRLKQLPKDIKKLVDLMHLDLWKCDGLTHMPPGLGQLTSLSYLS

Gene3D: G3DSA:3.80.10.10
530-668 G3DSA:3.80.10.10

AMLPSLLDVRKMRTFFLSNEPGYNGNKNQGLEIISNLRRVRALDAHNSGIVMVPRSLEKLKHIRFLDLSYNTRIETLPDSITKLQNLQVLKLAGLRRLKQLPKDIKKLVDLMHLDLWKCDGLTHMPPGLGQLTSLSYLS

HMMPfam: PF00560
IPR001611
591-613 LRR_1
Leucine-rich repeat

HIRFLDLSYNTRIETLPDSITKL

HMMPfam: PF00560
IPR001611
591-613 LRR_1
Leucine-rich repeat

HIRFLDLSYNTRIETLPDSITKL

Gene3D: G3DSA:3.80.10.10
710-877 G3DSA:3.80.10.10

ASEFRTANLKEKQHLQTLKLTWKSGDEDDNTASGSNDDVSLEELQPHENLQWLDVRGWGRLRFPSWVASLTSLVELRIDNCINCQNLPPLDQFPSLKHLTLDKLNDLKYIESGITYDRAESGPALFFPSLEKLWLRNCPNLKGWCRTDTSAPELFQFHCLAYFEIKSC

Gene3D: G3DSA:3.80.10.10
710-877 G3DSA:3.80.10.10

ASEFRTANLKEKQHLQTLKLTWKSGDEDDNTASGSNDDVSLEELQPHENLQWLDVRGWGRLRFPSWVASLTSLVELRIDNCINCQNLPPLDQFPSLKHLTLDKLNDLKYIESGITYDRAESGPALFFPSLEKLWLRNCPNLKGWCRTDTSAPELFQFHCLAYFEIKSC

superfamily: SSF52047
836-1064 SSF52047,LRR

FPSLEKLWLRNCPNLKGWCRTDTSAPELFQFHCLAYFEIKSCPNLTSMPLIPTVERMVFQNTSIKSMKDMLKLKLLLPQSASSSCSSSSLSPSLVQLKELSIQKIEDLDFLPDELLQNLTSLQQLDIIDCPRITTLSHDMQHLTSLEVLIIRACKELDLSSEQWQCLRSLRKLRIVNLAKLVSLHQGLQHVTTLQQLEICSCPILGTLPEWISGLTTLRHLEINECPLL

superfamily: SSF52047
836-1064 SSF52047,LRR

FPSLEKLWLRNCPNLKGWCRTDTSAPELFQFHCLAYFEIKSCPNLTSMPLIPTVERMVFQNTSIKSMKDMLKLKLLLPQSASSSCSSSSLSPSLVQLKELSIQKIEDLDFLPDELLQNLTSLQQLDIIDCPRITTLSHDMQHLTSLEVLIIRACKELDLSSEQWQCLRSLRKLRIVNLAKLVSLHQGLQHVTTLQQLEICSCPILGTLPEWISGLTTLRHLEINECPLL

Gene3D: G3DSA:3.80.10.10
920-1083 G3DSA:3.80.10.10

CSSSSLSPSLVQLKELSIQKIEDLDFLPDELLQNLTSLQQLDIIDCPRITTLSHDMQHLTSLEVLIIRACKELDLSSEQWQCLRSLRKLRIVNLAKLVSLHQGLQHVTTLQQLEICSCPILGTLPEWISGLTTLRHLEINECPLLSQKCSNNKGEDWSKIAHIP

Gene3D: G3DSA:3.80.10.10
920-1083 G3DSA:3.80.10.10

CSSSSLSPSLVQLKELSIQKIEDLDFLPDELLQNLTSLQQLDIIDCPRITTLSHDMQHLTSLEVLIIRACKELDLSSEQWQCLRSLRKLRIVNLAKLVSLHQGLQHVTTLQQLEICSCPILGTLPEWISGLTTLRHLEINECPLLSQKCSNNKGEDWSKIAHIP

FPrintScan: PR00364
IPR000767
976-992 DISEASERSIST
Disease resistance protein

QHLTSLEVLIIRACKEL

FPrintScan: PR00364
IPR000767
976-992 DISEASERSIST
Disease resistance protein

QHLTSLEVLIIRACKEL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox