PRGDB00062314 (Disease resistance protein RPM1, putative)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RPM1, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 223532668 (EQ974068)
Gene Class Unknown
Domain Type LRR
Gene Species Ricinus communis

Comment?

Ricinus communis genomic scaffold scf_1106159307508, whole genome shotgun sequence.

DNA Sequence

ATGCCTCTCTTCTACTTCGTGCGTGAATCAGAAAATAGAAGAGAGTTCTACTTCGTCGAGATGCCAAGAGCAAAATCTCAAGGTGATGTCGCTTCTAGCAGTAATCATATTGAAGAAGGAGAGAGCTCTTCTAATTCTAAAGGAAGCAAAGGTAAGACTTCTAGTTCAGAATATTTCATGTCAAACTATGAAAATCTTCCTGATCATCTCAAGTCATGCTTAGATTATTGTTTCATCATCACCTTTAGATATGGTGTAGACAAGGAAAAACTTCCTAGGCTTCTTTTGGCCGCATATACAGTACCAGAAAAATCGGGGGAAATCATGGAAGATGTAATAGAAAACATTATTGAGGAGTTTGTTAGATTGCAAATGCTTCAAGAAAATTACCATGCTGAAGTGAAAGTTTCTGAACCATATTTTGAACTTTTCCTTGTTGAAGTGGATGAACAAGATTTTGTTGCTAAAGCTGCAAACTTACCTGTATATGCTGTGATTGAAGATGATGGGAAGGACATTCCTCCTAACTTCAAAAGCCTTCAAATTCATTCTTTGTTTTTGATTACTGCTGAGCGACGTGCTCCTTCTTCCGTTTCTGCTCGAGGACTTTCTCGGGCCTACATGGAAACTTTTTGCAGGCTGCAATCCCTGGTGGTTTTAGGTTTAGATGGCGAGGTGGAGTGCTTGCCTGATAAAGTGGGAAGCCTAATTAATCTCAAGTATTTAGAGGTGCGGTGGTCAAATATAGATGACCTTCCAAGGACCTTAAATAATCTTCAGAAACTGCAAACTTTGGATGCAAGATGGAATAGATTTAGAAATCTACGTGAACTTCCAATAGAGATGTTAAATTCTCGACAGTCGAGGCACCTTTTGATGTCCCATACAACCAACAATGGTGAAATTAGAGTTTCAAAAGGCGTTGCAACAATGGTCAATCTTCAGACTTGTGATGGAGTGTATGCTGGAGGTGGGATTGCTAATGAATTGGGTGCCTTAGTCCAACTGAAAAAACTTGGTGTTAAGCGTATCTCTGAAGATCATGCTAGTGATCTATCTGCAGCCATCATGAAGATGTCAAAACTTGTCTCCTTGTCCTTGGAAGCAGAAGGAAGTTTCTTTGATGATACACAACTTCTTCCTGAAATCGAACAACTTTCTCCTCCACCGCTTCTTCGGGAGCTTATTTTAAGTGGTGGACTAGTTGAAATTCCCAAATGGATTTCCTCCATGGAAAACCTTACCACTCTAGGATTATTTCAGTCAAAGCTATTGGAGAACCCCAATTCAGTCCTTCAGTTTCTTCCAAAATTAAAACATCTCCGTCTACAGGATGCCTATAAGGCAAAATGCATTGGTAAAGAATTTTGTGAGGCAGGTGGTTTCCCAAAGCTGGAAACTCTATCAATTGTATCTCGGACTCTAGTGGAGTGGACTGAGATTGTAGAAGGAGCTTTTCCAAGTTTAAGGCGTCTCATTTTCTGGAACTGTTGCAGGTTGAGGTTTCTTCCTGAAAGTTTACAGAATATTTCTACACTTCAGGAATTAATTTTGTTTAATACACACAAAGATCTTGCCAGGAAACTTATTGGTCAAGAGAATTACAAGATTAAGGACATTCCAAAAGTGATAATCTATTGA


Protein sequences

Name Description Sequence
Disease resistance protein RPM1, putative Disease resistance protein RPM1, putative [Ricinus communis].

MPLFYFVRESENRREFYFVEMPRAKSQGDVASSSNHIEEGESSSNSKGSKGKTSSSEYFMSNYENLPDHLKSCLDYCFIITFRYGVDKEKLPRLLLAAYTVPEKSGEIMEDVIENIIEEFVRLQMLQENYHAEVKVSEPYFELFLVEVDEQDFVAKAANLPVYAVIEDDGKDIPPNFKSLQIHSLFLITAERRAPSSVSARGLSRAYMETFCRLQSLVVLGLDGEVECLPDKVGSLINLKYLEVRWSNIDDLPRTLNNLQKLQTLDARWNRFRNLRELPIEMLNSRQSRHLLMSHTTNNGEIRVSKGVATMVNLQTCDGVYAGGGIANELGALVQLKKLGVKRISEDHASDLSAAIMKMSKLVSLSLEAEGSFFDDTQLLPEIEQLSPPPLLRELILSGGLVEIPKWISSMENLTTLGLFQSKLLENPNSVLQFLPKLKHLRLQDAYKAKCIGKEFCEAGGFPKLETLSIVSRTLVEWTEIVEGAFPSLRRLIFWNCCRLRFLPESLQNISTLQELILFNTHKDLARKLIGQENYKIKDIPKVIIY

Disease resistance protein RPM1, putative Disease resistance protein RPM1, putative [Ricinus communis].

MPLFYFVRESENRREFYFVEMPRAKSQGDVASSSNHIEEGESSSNSKGSKGKTSSSEYFMSNYENLPDHLKSCLDYCFIITFRYGVDKEKLPRLLLAAYTVPEKSGEIMEDVIENIIEEFVRLQMLQENYHAEVKVSEPYFELFLVEVDEQDFVAKAANLPVYAVIEDDGKDIPPNFKSLQIHSLFLITAERRAPSSVSARGLSRAYMETFCRLQSLVVLGLDGEVECLPDKVGSLINLKYLEVRWSNIDDLPRTLNNLQKLQTLDARWNRFRNLRELPIEMLNSRQSRHLLMSHTTNNGEIRVSKGVATMVNLQTCDGVYAGGGIANELGALVQLKKLGVKRISEDHASDLSAAIMKMSKLVSLSLEAEGSFFDDTQLLPEIEQLSPPPLLRELILSGGLVEIPKWISSMENLTTLGLFQSKLLENPNSVLQFLPKLKHLRLQDAYKAKCIGKEFCEAGGFPKLETLSIVSRTLVEWTEIVEGAFPSLRRLIFWNCCRLRFLPESLQNISTLQELILFNTHKDLARKLIGQENYKIKDIPKVIIY

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF121
63-524 PTHR23155:SF121,SUBFAMILY NOT NAMED

YENLPDHLKSCLDYCFIITFRYGVDKEKLPRLLLAAYTVPEKSGEIMEDVIENIIEEFVRLQMLQENYHAEVKVSEPYFELFLVEVDEQDFVAKAANLPVYAVIEDDGKDIPPNFKSLQIHSLFLITAERRAPSSVSARGLSRAYMETFCRLQSLVVLGLDGEVECLPDKVGSLINLKYLEVRWSNIDDLPRTLNNLQKLQTLDARWNRFRNLRELPIEMLNSRQSRHLLMSHTTNNGEIRVSKGVATMVNLQTCDGVYAGGGIANELGALVQLKKLGVKRISEDHASDLSAAIMKMSKLVSLSLEAEGSFFDDTQLLPEIEQLSPPPLLRELILSGGLVEIPKWISSMENLTTLGLFQSKLLENPNSVLQFLPKLKHLRLQDAYKAKCIGKEFCEAGGFPKLETLSIVSRTLVEWTEIVEGAFPSLRRLIFWNCCRLRFLPESLQNISTLQELILFNTHKD

HMMPanther: PTHR23155
63-524 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

YENLPDHLKSCLDYCFIITFRYGVDKEKLPRLLLAAYTVPEKSGEIMEDVIENIIEEFVRLQMLQENYHAEVKVSEPYFELFLVEVDEQDFVAKAANLPVYAVIEDDGKDIPPNFKSLQIHSLFLITAERRAPSSVSARGLSRAYMETFCRLQSLVVLGLDGEVECLPDKVGSLINLKYLEVRWSNIDDLPRTLNNLQKLQTLDARWNRFRNLRELPIEMLNSRQSRHLLMSHTTNNGEIRVSKGVATMVNLQTCDGVYAGGGIANELGALVQLKKLGVKRISEDHASDLSAAIMKMSKLVSLSLEAEGSFFDDTQLLPEIEQLSPPPLLRELILSGGLVEIPKWISSMENLTTLGLFQSKLLENPNSVLQFLPKLKHLRLQDAYKAKCIGKEFCEAGGFPKLETLSIVSRTLVEWTEIVEGAFPSLRRLIFWNCCRLRFLPESLQNISTLQELILFNTHKD

HMMPanther: PTHR23155:SF121
63-524 PTHR23155:SF121,SUBFAMILY NOT NAMED

YENLPDHLKSCLDYCFIITFRYGVDKEKLPRLLLAAYTVPEKSGEIMEDVIENIIEEFVRLQMLQENYHAEVKVSEPYFELFLVEVDEQDFVAKAANLPVYAVIEDDGKDIPPNFKSLQIHSLFLITAERRAPSSVSARGLSRAYMETFCRLQSLVVLGLDGEVECLPDKVGSLINLKYLEVRWSNIDDLPRTLNNLQKLQTLDARWNRFRNLRELPIEMLNSRQSRHLLMSHTTNNGEIRVSKGVATMVNLQTCDGVYAGGGIANELGALVQLKKLGVKRISEDHASDLSAAIMKMSKLVSLSLEAEGSFFDDTQLLPEIEQLSPPPLLRELILSGGLVEIPKWISSMENLTTLGLFQSKLLENPNSVLQFLPKLKHLRLQDAYKAKCIGKEFCEAGGFPKLETLSIVSRTLVEWTEIVEGAFPSLRRLIFWNCCRLRFLPESLQNISTLQELILFNTHKD

HMMPanther: PTHR23155
63-524 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

YENLPDHLKSCLDYCFIITFRYGVDKEKLPRLLLAAYTVPEKSGEIMEDVIENIIEEFVRLQMLQENYHAEVKVSEPYFELFLVEVDEQDFVAKAANLPVYAVIEDDGKDIPPNFKSLQIHSLFLITAERRAPSSVSARGLSRAYMETFCRLQSLVVLGLDGEVECLPDKVGSLINLKYLEVRWSNIDDLPRTLNNLQKLQTLDARWNRFRNLRELPIEMLNSRQSRHLLMSHTTNNGEIRVSKGVATMVNLQTCDGVYAGGGIANELGALVQLKKLGVKRISEDHASDLSAAIMKMSKLVSLSLEAEGSFFDDTQLLPEIEQLSPPPLLRELILSGGLVEIPKWISSMENLTTLGLFQSKLLENPNSVLQFLPKLKHLRLQDAYKAKCIGKEFCEAGGFPKLETLSIVSRTLVEWTEIVEGAFPSLRRLIFWNCCRLRFLPESLQNISTLQELILFNTHKD

superfamily: SSF52058
104-520 SSF52058,LRR

KSGEIMEDVIENIIEEFVRLQMLQENYHAEVKVSEPYFELFLVEVDEQDFVAKAANLPVYAVIEDDGKDIPPNFKSLQIHSLFLITAERRAPSSVSARGLSRAYMETFCRLQSLVVLGLDGEVECLPDKVGSLINLKYLEVRWSNIDDLPRTLNNLQKLQTLDARWNRFRNLRELPIEMLNSRQSRHLLMSHTTNNGEIRVSKGVATMVNLQTCDGVYAGGGIANELGALVQLKKLGVKRISEDHASDLSAAIMKMSKLVSLSLEAEGSFFDDTQLLPEIEQLSPPPLLRELILSGGLVEIPKWISSMENLTTLGLFQSKLLENPNSVLQFLPKLKHLRLQDAYKAKCIGKEFCEAGGFPKLETLSIVSRTLVEWTEIVEGAFPSLRRLIFWNCCRLRFLPESLQNISTLQELILFN

superfamily: SSF52058
104-520 SSF52058,LRR

KSGEIMEDVIENIIEEFVRLQMLQENYHAEVKVSEPYFELFLVEVDEQDFVAKAANLPVYAVIEDDGKDIPPNFKSLQIHSLFLITAERRAPSSVSARGLSRAYMETFCRLQSLVVLGLDGEVECLPDKVGSLINLKYLEVRWSNIDDLPRTLNNLQKLQTLDARWNRFRNLRELPIEMLNSRQSRHLLMSHTTNNGEIRVSKGVATMVNLQTCDGVYAGGGIANELGALVQLKKLGVKRISEDHASDLSAAIMKMSKLVSLSLEAEGSFFDDTQLLPEIEQLSPPPLLRELILSGGLVEIPKWISSMENLTTLGLFQSKLLENPNSVLQFLPKLKHLRLQDAYKAKCIGKEFCEAGGFPKLETLSIVSRTLVEWTEIVEGAFPSLRRLIFWNCCRLRFLPESLQNISTLQELILFN

Gene3D: G3DSA:3.80.10.10
202-314 G3DSA:3.80.10.10

GLSRAYMETFCRLQSLVVLGLDGEVECLPDKVGSLINLKYLEVRWSNIDDLPRTLNNLQKLQTLDARWNRFRNLRELPIEMLNSRQSRHLLMSHTTNNGEIRVSKGVATMVNL

Gene3D: G3DSA:3.80.10.10
202-314 G3DSA:3.80.10.10

GLSRAYMETFCRLQSLVVLGLDGEVECLPDKVGSLINLKYLEVRWSNIDDLPRTLNNLQKLQTLDARWNRFRNLRELPIEMLNSRQSRHLLMSHTTNNGEIRVSKGVATMVNL

HMMPfam: PF12799
238-278 LRR_4,Leucine Rich repeats (2 copies)

NLKYLEVRWSNIDDLPRTLNNLQKLQTLDARWNRFRNLREL

HMMPfam: PF12799
238-278 LRR_4,Leucine Rich repeats (2 copies)

NLKYLEVRWSNIDDLPRTLNNLQKLQTLDARWNRFRNLREL

Gene3D: G3DSA:3.80.10.10
392-520 G3DSA:3.80.10.10

LRELILSGGLVEIPKWISSMENLTTLGLFQSKLLENPNSVLQFLPKLKHLRLQDAYKAKCIGKEFCEAGGFPKLETLSIVSRTLVEWTEIVEGAFPSLRRLIFWNCCRLRFLPESLQNISTLQELILFN

Gene3D: G3DSA:3.80.10.10
392-520 G3DSA:3.80.10.10

LRELILSGGLVEIPKWISSMENLTTLGLFQSKLLENPNSVLQFLPKLKHLRLQDAYKAKCIGKEFCEAGGFPKLETLSIVSRTLVEWTEIVEGAFPSLRRLIFWNCCRLRFLPESLQNISTLQELILFN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox